KEGG   Xanthobacter autotrophicus: Xaut_3011
Entry
Xaut_3011         CDS       T00581                                 
Name
(GenBank) conjugal transfer protein precursor
Organism
xau  Xanthobacter autotrophicus
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ABS68241
UniProt: A7IJP8
Position
complement(3350628..3351173)
AA seq 181 aa
MTRFGYVMVTYFVTMGVAVAAFIPIAPRLVWNASASVPVGLYDLGPTRHLEVGDLVAAMP
DKPLSDFMVARGYIGRDVPLMKRVMGLPGQRVCRTGNTITVDAVPLGEALDRDRLGRPLP
VWQGCRRIADGDIFLMNPDAHDSLDGRYFGPLPTRAVIGKATPLYTDEAGDGRFVWRATA
R
NT seq 546 nt   +upstreamnt  +downstreamnt
gtgactcgcttcggctatgtcatggtgacgtatttcgtgacgatgggcgtcgccgtcgcc
gctttcatcccgatcgcgccgcgcctcgtctggaatgcctcggccagcgtgccggtcggt
ctctacgaccttggcccgacgcgccatttggaagtcggcgatctcgtcgcggccatgcca
gacaagccactgtccgacttcatggtcgctcgcggctatatcggccgcgacgtgccgctg
atgaagcgcgtcatggggcttcccggtcaacgggtctgccgcaccggcaacaccatcacc
gtcgatgccgtgccgctcggcgaggcgctcgaccgcgaccgactcggccgcccattgccc
gtctggcaaggctgccgccgcatcgcggatggcgacatcttcctcatgaatcccgacgcg
cacgacagtctggacggtcgctacttcggcccgcttccgacgcgcgcggtcatcggcaag
gcgacgccgctctacaccgacgaggccggcgacggccgcttcgtctggcgcgcgacggca
cgctga

DBGET integrated database retrieval system