KEGG   Xanthobacter autotrophicus: Xaut_3108Help
Entry
Xaut_3108         CDS       T00581                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00071  Fatty acid degradation
xau00072  Synthesis and degradation of ketone bodies
xau00280  Valine, leucine and isoleucine degradation
xau00310  Lysine degradation
xau00362  Benzoate degradation
xau00380  Tryptophan metabolism
xau00620  Pyruvate metabolism
xau00630  Glyoxylate and dicarboxylate metabolism
xau00640  Propanoate metabolism
xau00650  Butanoate metabolism
xau00900  Terpenoid backbone biosynthesis
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01200  Carbon metabolism
xau01212  Fatty acid metabolism
xau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Xaut_3108
   00630 Glyoxylate and dicarboxylate metabolism
    Xaut_3108
   00640 Propanoate metabolism
    Xaut_3108
   00650 Butanoate metabolism
    Xaut_3108
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Xaut_3108
   00072 Synthesis and degradation of ketone bodies
    Xaut_3108
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Xaut_3108
   00310 Lysine degradation
    Xaut_3108
   00380 Tryptophan metabolism
    Xaut_3108
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Xaut_3108
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Xaut_3108
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Xaut_3108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xau04147]
    Xaut_3108
Enzymes [BR:xau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Xaut_3108
Exosome [BR:xau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Xaut_3108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C YadA_head
Motif
Other DBs
NCBI-ProteinID: ABS68338
UniProt: A7IJZ5
Position
complement(3447758..3448936)
Genome map
AA seq 392 aa AA seqDB search
MKDEVVIVSAARTPVGSFNGALAPLPAHELGAIAIKAALERAGLPADTVSEVILGQVLTA
AQGQNPARQASLKAGLPIGVPAWEVQMVCGSGLRSVALGAQAIVNGDSEIVVAGGQESMS
QSTHAAHVRNGTRMGGLEFVDTMIKDGLWDAFNGYHMGNTAENVARQFQITRQEQDEFAV
ASQNKAEAAQKGGKFKEEIVPVTISTRKGDVVVDQDEYIRHGASIEAMTKLKPAFAKDGT
VTAGNASGINDGAAAVVLMSAAKAKAEGRTPLARIVSWAQAGVDPSIMGTGPIPASRLAL
EKAGWSASDLDLVEANEAFAAQAIAVNKDLGWDTSKVNVNGGAIAIGHPIGASGTRILVT
LLHEMQKRDAKKGLATLCIGGGMGIAMCLARD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgaggtcgtcatcgtcagcgcagcgcgcaccccggtcgggtcgttcaacggc
gcgctcgcgccgttgcccgcccatgagctgggcgcgatcgccatcaaggcggcgctggag
cgcgccggacttcccgccgataccgtcagcgaagtgattctcggtcaggtgctgactgca
gcccaaggccagaaccccgcccgccaggcctcgctgaaggccggcctgcccatcggcgtc
ccggcgtgggaagtgcagatggtgtgcggctccgggctgcgctccgtggcgctgggcgct
caggccatcgtcaacggcgacagcgaaatcgtcgtggccggcggccaggaatccatgagc
cagtccacccacgcggcccacgtgcgcaacggcacccgcatgggcggcctcgagttcgtg
gacaccatgatcaaggacggcctgtgggatgccttcaatggctaccacatgggcaacacc
gccgagaacgtggcgcgccagttccagatcacccgccaggagcaggacgagttcgccgtc
gcttcccagaacaaggcggaagcggcccagaagggcggcaagttcaaggaggagatcgtc
cccgtcaccatctccacccgcaagggcgacgtggtggtggaccaggacgaatacatccgc
cacggtgccagcatcgaggccatgaccaagctgaagcccgccttcgccaaggacggcacg
gtgaccgccggcaacgcctccggcatcaatgacggcgccgccgccgtggtgctcatgagc
gccgccaaggccaaggccgagggccgcaccccgctggcccgcatcgtctcctgggcgcag
gccggcgtcgatccgtcgatcatgggcacgggtcccatccccgcctcccgcctcgcgctg
gagaaggccggctggagcgcctcggacctcgacctggtggaagccaacgaggccttcgcc
gcccaggccatcgccgtgaacaaggacctcggctgggataccagtaaggtgaacgtgaac
ggcggcgccatcgccatcggccaccccatcggcgcctcgggcacccgcatcctggtgacc
ctgctgcacgagatgcagaagcgcgacgccaagaagggccttgccaccctgtgcatcggc
ggcggcatgggcatcgccatgtgccttgcgcgggactga

DBGET integrated database retrieval system