KEGG   Xanthobacter autotrophicus: Xaut_3136Help
Entry
Xaut_3136         CDS       T00581                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00230  Purine metabolism
xau01100  Metabolic pathways
Module
xau_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Xaut_3136
Enzymes [BR:xau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Xaut_3136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_33 AAA_22 RsgA_GTPase cobW AAA_16 Sp38 TsaE
Motif
Other DBs
NCBI-ProteinID: ABS68366
UniProt: A7IK23
Position
3479034..3479729
Genome map
AA seq 231 aa AA seqDB search
MPQSASSSVSSHFALPGWKPGAGILARRGLMLVLSSPSGAGKTTLSRKLLASDDRITMSV
SVTTRPPRPGEVEGKDYYFVDVPTFHRMRDEGELLEHAVVFDNLYGTPRPAVELALSAGR
DVLFDIDWQGTQQLGETAQQDLVKVFLLPPTAADLEQRLRSRAQDSEEVVHQRMAKASDE
ISHYTEYDYIIINHEVDDSLVKLTAILQAERLKRRRLTGLSSFVKGLRDAL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaatccgcctcttcctccgtgtcgtcgcacttcgcgctgccgggctggaagccg
ggcgcgggtatcctcgcgcggcgcgggctgatgctggtgctgtcctcgccatcgggcgca
ggcaagaccaccctgtcgcgcaagctgctggcgagcgacgatcgaatcaccatgtccgtg
tccgtcaccacgcggccgccccggccgggcgaggtggagggcaaggactattatttcgtg
gacgtgcccaccttccaccgcatgcgggacgagggcgaactgctggagcacgcggtggtg
ttcgacaatctctacggcacgccgcgccccgccgtggaactggccctatccgccggccgg
gacgtgctgttcgacatcgactggcagggcacccagcagttgggcgagaccgcccagcag
gacctggtgaaagtcttcctgttgccgcccaccgccgcggaccttgagcagcgcctgcgc
tcccgcgctcaggattcggaagaggtggtgcaccagcgcatggccaaggcctccgacgag
atcagccactataccgaatacgactacatcatcatcaaccacgaggtggacgacagcctc
gtcaagctcaccgccatcctgcaggcggaacggctgaagcgccggcgcctgaccggcctg
tcgagcttcgtgaagggcctgcgcgacgccctgtga

DBGET integrated database retrieval system