KEGG   Xanthobacter autotrophicus: Xaut_3243Help
Entry
Xaut_3243         CDS       T00581                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00970  Aminoacyl-tRNA biosynthesis
xau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xau00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Xaut_3243
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xau03029]
    Xaut_3243
Enzymes [BR:xau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Xaut_3243
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Xaut_3243
Mitochondrial biogenesis [BR:xau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Xaut_3243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABS68472
UniProt: A7IKC9
Position
3596165..3597589
Genome map
AA seq 474 aa AA seqDB search
MSGFFTLGVVEMADAVADGSVSSEALAEEALQRLETLGPRYNAVMQIEPERAREAARAVD
LARARGDKLGPLAGVPLAHKDLLYRAGRVATGGSLIRKDFVPDVTSSVLERLDAAGALDL
GSLHLAEFALSPTGFNVHYGHGLSPWNTAYGAGGSSSGSGAAVAARMVPGALGSDTGGSI
RHPSAMCGVTGLKPTHGLVPLYGAMPLAPSLDTIGPLTRTARDAARMMTAIAGPDPRDGA
TLPAPRLDFEGGLKGDLKGLTIAVPSGYYRELATPEIAALMDDSRAVLKDAGAQLIETSP
PDMALVNALMQVVMLVEMSTLHRRWLTERPQDYSLQVRARMLPGLALPATRYAEALMMRA
SVTRDWLATTMGAADMVHMPTLPVAVPSIAETTAGPPEDIAAVVGRLAAFTRGINYLGLP
SLSVPCGFTANGLPAAFQLVGRPYADPVLLKAGDAYQRRTDFHALLPPGCGALA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctttttcaccctcggcgtggtcgagatggcggacgccgtggccgatggctcg
gtgtcgtccgaagccctcgccgaggaggcgctgcagcggcttgaaaccctcggcccgcgc
tacaacgccgtgatgcagatcgagcccgagcgggcgcgcgaggcggcgcgcgcggtcgat
ctcgcgcgggcacggggcgacaagctggggccgcttgccggcgtgcctctggcgcacaag
gacctgctctatcgcgccggccgcgtcgccaccggcggctcgctgatccgcaaggatttc
gtgccggatgtgacctcaagcgtgctggagcggctggatgcggcgggggcgctggacctc
ggctccctgcaccttgccgaattcgcgctctcgcccaccggcttcaatgtccattacggc
catggcctcagcccgtggaacaccgcctatggcgccggcggctcctcgtccggctcgggg
gcggcggtggcggcgcgcatggtcccgggggcgctgggatcggacaccggcggctccatc
cgccatccctctgccatgtgcggggtgacggggctgaagcccacccacggcctcgtgccg
ctttacggcgccatgccgctggcgccgagcctcgacaccatcggcccgctgacccgcacc
gcccgcgatgcggcgcgcatgatgacggccatcgccggtcccgacccgcgtgatggtgcc
accctgccggcgccgcgcctcgatttcgagggcgggcttaagggggacctcaagggcctc
accatcgctgtgccctccggctattaccgcgagctggcgacgccggagatcgccgcgctc
atggacgacagccgcgccgtgctgaaggacgcgggcgcgcagctcatcgagaccagccca
cccgacatggcgctggtgaacgcgctgatgcaggtggtgatgctggtggagatgtccacc
ctccaccgccgctggctcaccgagcggccgcaggactacagcttgcaggtacgcgcccgc
atgcttccgggcctcgctttgccggccacccgctacgccgaggccctgatgatgcgcgcc
agcgtgacgcgcgactggctcgccaccaccatgggtgcggcggacatggtgcacatgccg
acccttccggtggcggtgcccagcatcgccgagaccaccgccggcccgccggaggatatc
gccgccgtggtggggcgcctcgcggcgttcacgcggggcatcaattatctcggcctgccc
agcctgtcggtgccgtgcggcttcaccgccaacggcctgccggccgccttccagctggta
ggccggccctatgccgatccggtgctgctgaaggccggcgatgcctatcagcgccgcacc
gatttccacgccctgctgccgccgggctgcggcgcgctcgcgtga

DBGET integrated database retrieval system