KEGG   Xanthobacter autotrophicus: Xaut_3524Help
Entry
Xaut_3524         CDS       T00581                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00260  Glycine, serine and threonine metabolism
xau00750  Vitamin B6 metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01230  Biosynthesis of amino acids
Module
xau_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xaut_3524
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Xaut_3524
Enzymes [BR:xau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Xaut_3524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABS68753
UniProt: A7IL60
Position
3930856..3932268
Genome map
AA seq 470 aa AA seqDB search
MRYVSTRGEAPVLSFSDALLAGLARDGGLYLPEAWPTLSRDEIAALAGKPYAAVAKAVIG
PFVGDALPPRALDLMIDDAYAGFRHPAVAPLTQIGANRFLLELFHGPTLAFKDVAMQLLA
RLMDHVLASRGSRATIVGATSGDTGSAAIEAFRRSDAVDVFILYPHGRVSEVQRRQMTTV
NSPSVHAIAVEGTFDDCQNLVKAMFNHHAFRDSLALAGVNSINWARIVAQVVYYFYAATA
LGAPHRDVSFVVPTGNFGDILAGWVAKKMGLPIRDLTIATNVNDILVRTLDTGRYEVKGV
LPSSSPSMDIQISSNFERLLFEALDRDSAVLRQLMDQLAQSGSFSVPRAALAAICADFSA
GRADEPETAATIARLYQSAGYLCDPHTAVGLAVADKVEHAARVPQVVLSTAHPAKFPDAV
EAATGHRPALPPHMADLMTRRESVSVLPNDLAAIETFIRAHARIARGAAA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttacgtttccacccgtggtgaagctcccgttctctccttttccgacgcgctgctc
gcggggcttgcgcgcgacggcggcctctatctgcccgaggcctggccgaccctctccagg
gatgagatcgccgcgctggcgggaaaaccctacgctgccgtcgccaaggccgtgatcggc
ccgttcgtgggcgacgcgctgccgccgcgcgccctcgacctgatgatcgacgacgcctat
gcgggcttccgtcatccggccgtggccccgctgacccagatcggcgccaaccgcttcctc
cttgagctattccacggcccgaccctcgccttcaaggacgtggcgatgcagctgctcgcc
cggctgatggaccatgtgctggcctcgcgcggcagccgggccaccatcgtgggcgccact
tccggcgacaccggcagcgcggccatcgaggcgttccggcgctcggacgcggtggatgtc
ttcatcctctatccccacggccgggtgtccgaggtgcagcgccggcagatgaccacggtg
aattcgccgagcgtccatgccattgccgtggaaggcacgttcgacgactgccagaacctg
gtcaaggccatgttcaaccaccacgccttccgcgactccctggcgctggcaggggtgaat
tccatcaactgggcgcggatcgtggcccaggtggtctattatttctatgccgccaccgcc
ctgggcgcgccccatcgggacgtctccttcgtggtgcccaccggcaatttcggcgatatc
ctcgccggctgggtggcgaagaagatgggcctgccgatccgcgacctcaccatcgccacc
aacgtcaacgacatcctggtgcgcaccctggacaccggccgctatgaggtgaagggggtg
ctgccctcctcctcgccgtccatggatatccagatctcctccaatttcgagcgcctgctg
ttcgaggccctggaccgcgacagcgcggtgctgcgccagctgatggatcagctcgcccag
tcgggctccttcagcgtgccgcgcgctgcgctcgccgccatctgcgccgacttctccgcc
ggccgagccgacgagccggagaccgctgccaccatcgccaggctctaccagtccgccggc
tatctctgcgatccgcacacggcggtgggccttgcggtggcggacaaggtggagcacgcg
gccagggtgccgcaggtggtgctctccaccgcccaccccgccaagttccccgacgcggtg
gaagccgccaccggccatcgtccggccctgccgccgcacatggcggacctcatgacccgc
cgggagagcgtcagcgtgctgcccaacgaccttgccgccatcgagaccttcattcgcgcc
catgcgcgcatcgcccggggcgcggcggcatga

DBGET integrated database retrieval system