KEGG   Xanthobacter autotrophicus: Xaut_4103Help
Entry
Xaut_4103         CDS       T00581                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
xau  Xanthobacter autotrophicus
Pathway
xau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xau00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Xaut_4103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABS69325
UniProt: A7IMT2
Position
4539914..4540306
Genome map
AA seq 130 aa AA seqDB search
MRLIMASVLMLAATGSAFADPDVAKGETTFKKCMACHAIGPDAKVKVGPPLNGIVGAKWA
HFEGYAYSADIKDGAAAGKVWDEATLDNYISNPKVLAPKGKMAFAGVKNDDERKDLIAFL
AQFNADGSKK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcattatggcttcggttctcatgcttgccgctaccggctcggcctttgcggat
cccgatgttgcgaagggcgagaccaccttcaagaagtgcatggcgtgccacgccatcggc
cccgacgccaaggtgaaggtcggcccgcccctgaacgggatcgtcggcgccaagtgggcc
cacttcgagggctatgcctattccgccgacatcaaggacggcgccgccgccggcaaggtg
tgggacgaggccaccctggacaactacatcagcaaccccaaggtgctcgcccccaagggc
aagatggccttcgccggcgtcaagaacgacgatgagcgcaaggacctcatcgctttcctc
gcccagttcaacgccgacggcagcaagaagtaa

DBGET integrated database retrieval system