KEGG   Xanthobacter autotrophicus: Xaut_4234Help
Entry
Xaut_4234         CDS       T00581                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xau  Xanthobacter autotrophicus
Brite
Enzymes [BR:xau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Xaut_4234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 MTS Methyltransf_11 GidB Methyltr_RsmB-F PrmA Methyltransf_23 Methyltransf_32 Cons_hypoth95 Methyltransf_18 DUF1485 Methyltransf_PK Methyltransf_12 DUF938
Motif
Other DBs
NCBI-ProteinID: ABS69455
UniProt: A7IN62
Position
4695007..4695669
Genome map
AA seq 220 aa AA seqDB search
MIDFVELRRGMVDGQVRTNNVTDPRIVAAMLEIPREKFVPAPLKSLAYIDDDLALTSGNA
PRYLIEPMILARLVQLADVQEHEHVLDVGTGTGYSAAVLSRLAQQVVAVEEDAGLAATAT
ATLAELGVGNVAVMQGPLNAGWAAEAPYDLILLNGAVDEVPANLFAQVKEGGRVVAVVGH
GGAGQARVFTKVAGAMSERVAFNAAVPALPGFKAAPRFVF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttcgtcgagcttcgccgcggcatggtggacgggcaggtccgcaccaacaac
gtcaccgatccgcgcatcgtcgccgccatgctggagatcccgcgcgagaagttcgtgccg
gcgccgctgaagtccctcgcatatatcgacgacgatctggcgctcacctccggcaatgcc
ccgcgctatctcatcgagcccatgattctcgcgcgcctggtgcagctcgccgacgtacag
gagcatgagcacgtgctcgatgtgggcaccggcaccggctattcggccgccgtgctgtcg
cgcctcgcgcagcaggtggtcgccgtggaggaagacgccggcctcgccgcgaccgcgacg
gcgaccctcgccgagctgggcgtcggtaacgtggcggtgatgcaggggccgctgaacgcc
ggctgggccgccgaggcgccctacgacctcatcctgctcaacggggcggtggacgaggtg
ccggccaacctcttcgctcaggtgaaggagggcggccgagtcgtcgccgtggtcggccat
gggggcgccggacaggcccgcgtgttcaccaaggtggccggtgccatgagcgagcgggtg
gccttcaacgccgccgtgcccgcgctgcccggcttcaaggccgcgccacgcttcgttttc
tga

DBGET integrated database retrieval system