KEGG   Xanthobacter autotrophicus: Xaut_4252Help
Entry
Xaut_4252         CDS       T00581                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00620  Pyruvate metabolism
xau00630  Glyoxylate and dicarboxylate metabolism
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Xaut_4252
   00630 Glyoxylate and dicarboxylate metabolism
    Xaut_4252
Enzymes [BR:xau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Xaut_4252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABS69473
UniProt: A7IN80
Position
4717931..4720102
Genome map
AA seq 723 aa AA seqDB search
MASGTEARVERAGLQIARTLHDFIETEALPGSGIEADVFWEGLSAIAHDLAPRNRELLAR
REELQKTLDQWYRDNGTPLDLEAYKAFLTKIGYLVPEGPAFSVTTANVDPEIAEVAGPQL
VVPVMNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGYNPVRGAKVIAWGRAFLD
ESAPLKAGSWADAGPLSVKDGALAVGATGLADPSQFAGYRGEASAPSAVLLKKNGLHVEI
VVDRASVIGKDDTAGISDLVLEAALTTIQDCEDSVAAVDAEDKVAVYRNWLGLMSGDLKE
EIAKGGRIFTRSLNPDREYTAPDGCTLVLPGRSLMLVRNVGHLMTNPAILLKDGSEIPEG
IMDAAVTALIALRDIGPNGRRANSRAGSMYVVKPKMHGPEEVAFAVEIFDRVEDLLGLPS
DTIKMGIMDEERRTTVNLKESIRAASSRVAFINTGFLDRTGDEIHTSMEAGPMVRKGDMK
QAAWISAYEARNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHQVQAALRSRPKAKLDDLLTIPVAVRPNWTPEDIQHELDNNAQG
ILGYVVRWVDQGVGCSKVPDIHDVGLMEDRATLRISAQHMANWLRHGVCSEAQVLETLKR
MAAVVDRQNAGDPLYRPMAPDFTSIAFQAACDLVFKGREQPSGYTEPLLHQRRLELKAQS
AAA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgggaccgaggcccgggtggaacgcgccgggctgcaaatcgcgcgtactctg
cacgacttcattgaaaccgaggcattgcccggcagcggcatcgaggcggacgtcttctgg
gagggcctttccgccatcgcccacgacctggcaccgcgcaaccgcgaactcctggcgcgg
cgcgaggagctgcagaagaccctcgaccagtggtatcgcgacaatggcacccccctcgat
ctggaggcctacaaggccttcctgacaaagatcggctatctggtgcccgaaggccccgcc
ttcagcgtgaccacggccaatgtggaccccgagatcgccgaagtggccggcccgcagctg
gtcgtgccggtgatgaacgcgcgctacgcgctgaatgccgccaatgcgcgctggggctcg
ctctatgacgcgctctacggcaccgacgccatccccgagaccgacggcgccgagaagggc
aagggctacaatcccgtccgcggcgccaaggtcatcgcctggggccgcgcgttcctcgac
gagagcgcgcccctgaaggccggctcctgggccgatgccggtccgctgtcggtcaaggac
ggcgcccttgcggtcggcgccaccggccttgcggacccgtcccagttcgccggctatcgg
ggcgaggcctcggcgccgtccgccgtgctgctgaagaagaacggcctccatgtggagatc
gtggtggaccgcgccagcgtcatcggcaaggacgataccgccggcatctccgacctggtg
ctggaagccgccctcaccaccatccaggactgcgaggattccgtcgccgccgtggatgcg
gaggacaaggtcgcggtctaccgcaactggctcggcctgatgagcggcgacctcaaggag
gagatcgccaagggcgggcgcatcttcacccgcagcctgaatcccgaccgggaatatacc
gcgccggacggctgcaccctggtgctgccgggccgctcgctcatgctggtgcgcaacgtg
ggccacctcatgaccaatccggccatcctgctgaaggacggctcggaaatccccgagggc
atcatggatgccgccgtcaccgcgctcatcgccctgcgcgacatcggccccaacggacgc
cgcgccaacagccgcgccggctccatgtatgtggtcaagcccaagatgcacgggccggaa
gaggtggcgttcgcggtggagatcttcgaccgcgtcgaggatctgctgggcctgcccagc
gacaccatcaagatgggcatcatggacgaggagcgccgcaccacggtgaacctgaaggag
agcatccgcgccgcatccagccgggttgccttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacttccatggaagccggccccatggtccgcaagggcgacatgaag
caggctgcctggatcagcgcctacgaggcccgcaacgtggacatcggcctggagtgcggc
cttgccggccatgcccagatcggcaagggcatgtgggccatgccggacctgatggccgcc
atgcttgagcagaagatcgcccaccccaaggccggcgccaacaccgcctgggtgccgtcg
cccactgccgccaccctgcacgccacccactatcacaaggtggacgtgcatcaggtgcag
gccgcgctgcgcagccgcccgaaggccaagctggacgatctcctgaccatcccggtggcg
gtgcggccgaactggacgcccgaggacatccagcacgagctggacaacaatgcccagggc
atcctcggctatgtggtgcgctgggtcgaccagggcgtcggctgctccaaggtgccggac
atccacgacgtgggcctgatggaggatcgcgccaccctgcgcatctccgcccagcacatg
gctaactggctgcgccacggcgtgtgcagcgaggcgcaggtgctggagacactgaagcgc
atggcggcggtggtggaccggcagaatgccggcgatccgctctaccggcccatggcgccg
gacttcacctccatcgccttccaggccgcctgcgacctcgtcttcaagggccgcgagcag
ccgagcggctacaccgagccgctgctccaccagcgccggctggagctgaaggcgcagagc
gccgcggcctga

DBGET integrated database retrieval system