KEGG   Xanthobacter autotrophicus: Xaut_4296Help
Entry
Xaut_4296         CDS       T00581                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00071  Fatty acid degradation
xau00280  Valine, leucine and isoleucine degradation
xau00281  Geraniol degradation
xau00310  Lysine degradation
xau00360  Phenylalanine metabolism
xau00362  Benzoate degradation
xau00380  Tryptophan metabolism
xau00410  beta-Alanine metabolism
xau00627  Aminobenzoate degradation
xau00640  Propanoate metabolism
xau00650  Butanoate metabolism
xau00903  Limonene and pinene degradation
xau00930  Caprolactam degradation
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01120  Microbial metabolism in diverse environments
xau01130  Biosynthesis of antibiotics
xau01212  Fatty acid metabolism
Module
xau_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Xaut_4296
   00650 Butanoate metabolism
    Xaut_4296
  Lipid metabolism
   00071 Fatty acid degradation
    Xaut_4296
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Xaut_4296
   00310 Lysine degradation
    Xaut_4296
   00360 Phenylalanine metabolism
    Xaut_4296
   00380 Tryptophan metabolism
    Xaut_4296
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Xaut_4296
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Xaut_4296
   00281 Geraniol degradation
    Xaut_4296
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Xaut_4296
   00627 Aminobenzoate degradation
    Xaut_4296
   00930 Caprolactam degradation
    Xaut_4296
Enzymes [BR:xau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Xaut_4296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABS69517
UniProt: A7INC3
Position
4763830..4764900
Genome map
AA seq 356 aa AA seqDB search
MTTEPEVLLEEKGAAGIITLNRPKALNALNLAMVREILPRLRAWAKDPAITRVIIKGAGE
KAFCAGGDVRSIYDLGLSGRAEEALGFFREEYVLNDYIGSFPKPYVALIDGICMGGGFGL
SAHGAHRVAGDRYLFAMPEVNIGLFPDVGGTHVLPRLPGAFGVFLALTGTRIRAAEAHAC
GLATDVVPSAAFPALEEALVAGGDVERILAEHRIDPGPGTFASRADFIADTFGRPDVPAI
LAALDDAAVAGGEHGEFAAATAREVRLRSPTSLCIAMEQMRRGRALDLGACLKLELRVVT
RVMAGHDFYEGVRAVLVDRDNAPKWQPSKLEEVDSAVIAAHFDPIPNELELLAPGA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacggaacctgaggttctgctggaagagaagggcgcagccggcatcatcacgctc
aaccggcccaaggcgctcaacgccttgaaccttgccatggtgcgcgagatcctgccgcgc
cttcgggcctgggcgaaggatcccgccatcacccgcgtcatcatcaagggtgccggcgaa
aaggccttctgcgccggcggtgacgtacgctccatctacgacctgggcctctccggccgc
gccgaggaagcgctcggcttcttccgcgaggaatatgtcctcaacgactatatcggcagc
tttcccaagccctatgtggcgctgatcgacggcatctgcatgggcggcggcttcggcctc
tcggcccatggtgcgcaccgggtggcgggcgaccgctacctgttcgccatgccggaggtg
aatatcggcctgttccccgatgtgggcggcacccatgtgctgccgcgcctgcccggcgcc
ttcggcgtgttcctggccctgaccgggacgcgaatccgcgccgccgaggctcatgcctgc
gggctcgccaccgacgtggttccctctgccgccttccccgcattggaggaggctctcgtg
gcaggcggcgacgtggagcggattctcgccgagcatcgtatcgatccggggccggggaca
ttcgccagccgcgccgatttcatcgccgacacgttcggccgccccgatgtgccggccatc
ctcgccgccctcgatgacgctgcggtggccggtggggagcatggggaattcgccgcagcc
accgcccgcgaggtgcgcctgcgttcccccaccagcctgtgcatcgcaatggagcagatg
cgccggggccgggcgctggatcttggcgcctgcctgaagctggaactgcgcgtggtgacg
cgcgtcatggccggccacgacttctacgagggcgtgcgcgcggtgctggtggaccgcgac
aatgccccgaaatggcagccgtcaaagctcgaagaggtggacagcgccgtcattgcggcg
catttcgatcccatccccaacgaactggaattactggcaccgggtgcatga

DBGET integrated database retrieval system