KEGG   Xanthobacter autotrophicus: Xaut_4375Help
Entry
Xaut_4375         CDS       T00581                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01130  Biosynthesis of antibiotics
xau01230  Biosynthesis of amino acids
Module
xau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xaut_4375
Enzymes [BR:xau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Xaut_4375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABS69596
UniProt: A7INK2
Position
complement(4850791..4851582)
Genome map
AA seq 263 aa AA seqDB search
MTDILKKIEAYKRDEIAVAKHARPLGEIEAAARAAPRVRPFAGAIATSLAEGRTALIAEI
KKASPSKGLIRADFDPPALARAYQRGGATCLSVLTDTPSFQGAPEFLGSARAAVDLPVLR
KDFMYDTYQVAEARAWGADCILIIMAGVDDLLARDLADAAAAYGMDAIVEVHDDAELERA
LDLPCRLIGINNRNLRTFETSLETSERLAPRVPKDRIAIGESGIFTPQDVARLAKVGIGT
ILVGESLMRQEDVASATSQLLAV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattttgaagaagattgaagcctacaagcgcgacgagattgccgtcgccaag
catgcccgtccgctgggagagatcgaggcggcggcccgtgctgcgccgcgcgtgcggccg
tttgccggagccatcgccaccagtctggctgaagggcgcaccgcgctcattgcggagatc
aagaaggcgagtccctccaagggcctgatccgggcggacttcgatccgccggcgctggcc
cgcgcctaccagcgcggcggcgccacctgcctgtccgtgctcaccgacactccctccttc
cagggcgcgccggaattcctcggctccgcgcgcgcggcggtcgacctgccggtgctgcgc
aaggacttcatgtacgacacctaccaggtggcggaggcccgcgcctggggggcagactgc
atcctcatcatcatggccggggtggacgacctgctcgcccgtgacctcgctgatgccgcc
gccgcttatggcatggacgccatcgtggaggtgcacgacgacgccgagctggaacgggcg
ctggacctgccgtgccggctcatcggcatcaacaaccgcaacctgcgcaccttcgagacc
tcgctcgaaacctccgagcgcctcgcaccccgcgtgccgaaggaccggatcgccatcggc
gagagcggcatcttcacgccgcaggacgtagcgcggctcgcgaaggttggcatcggcacc
atcctcgtaggcgagagcctgatgcggcaggaggatgtcgcttccgccacgtcccagctc
cttgcggtctag

DBGET integrated database retrieval system