KEGG   Xanthobacter autotrophicus: Xaut_4433Help
Entry
Xaut_4433         CDS       T00581                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00900  Terpenoid backbone biosynthesis
xau01100  Metabolic pathways
xau01110  Biosynthesis of secondary metabolites
xau01130  Biosynthesis of antibiotics
Module
xau_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:xau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Xaut_4433
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Xaut_4433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ABS69654
UniProt: A7INR0
Position
complement(4919373..4920542)
Genome map
AA seq 389 aa AA seqDB search
MKRLSILGATGSIGHSVRTLLADAPGLYEVEAVAGGRDVAALAETARALNARFAAIADPA
AGRALAEALAGSGIASGAGPSALIEAAQREADVVVSAIVGVAGLAPTVAAFAPGRRIALA
NKECLVAAGAFFMAEAARQGTEILPVDSEHNAIFQALEAGPRKAVEKITLTASGGPFRLK
SREEIARALPKDALKHPNWSMGAKITIDSATLMNKGLELIEAMHLFALPPERFDAVVHPE
SVVHGLVSFVDGSVTAGLAMPDMCVPIAHCLAFPDRIVTSCRRLDLVALGRLSFEAPDEA
RFPALALARAAMAADGMAATILNAANEVAVAAYLEGRIGFYGITDTVAATLDRINGGPAP
ASVADAMEADAQARRAAAVLLPKFSAKAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctttccatcctcggggccaccggctccatcggccacagcgtccggaccctc
ctggccgatgcgcccggcctctatgaggtggaagcggtcgccggcggacgggatgtcgcg
gcactggccgagaccgcccgtgcgctcaatgcgcgctttgccgccatcgccgatccggcg
gcgggcagggcgctcgccgaagcgctggccggctccggcatcgccagcggcgccggtccc
tcggccctgatcgaggcggcccagcgcgaggcggacgtggtggtaagcgccatcgtcggc
gtggcgggccttgcgcccaccgtggctgccttcgcgccgggccggcgcatcgcgctggcc
aacaaggaatgtctggtggccgccggtgccttcttcatggccgaggcggcgcggcagggc
accgagatcctgcccgtggacagcgagcacaacgccatcttccaggcgctggaggccggc
ccacgcaaggcggtggagaagatcacgctcacggcctcgggcggcccgttccggctgaaa
agccgggaggagatcgcgcgggcactgccgaaggatgcgctcaagcaccccaactggtcg
atgggcgccaagatcaccatcgattcggccaccctcatgaacaagggcctcgaactgatc
gaggcgatgcacctgttcgccctgccgcccgagcgcttcgacgcggtggtgcatcccgag
tcggtggtccacgggctggtgtcgtttgtcgatgggtccgtgacagccggcctcgccatg
cccgacatgtgcgtgccgatcgcccattgcctggcgtttccggatcgaatcgtcacctcc
tgccgccggctggacctggtggccctgggccgcctcagcttcgaggcgccggacgaggcc
cgcttcccggcgctggcgctcgcccgcgccgccatggccgccgacgggatggccgcaacc
attctgaacgcggccaacgaggtggcggtcgcggcgtatcttgaggggcggatcggcttt
tacggcatcaccgataccgtggccgcgacgctggaccgcatcaatggcggtcctgcgccc
gccagcgtcgccgatgccatggaggcggatgcacaggcgcgccgtgctgctgccgtgctc
ttgcctaagttttccgcaaaggcatcttag

DBGET integrated database retrieval system