KEGG   Xanthobacter autotrophicus: Xaut_4910
Entry
Xaut_4910         CDS       T00581                                 

Definition
(GenBank) Isoprenylcysteine carboxyl methyltransferase
Organism
xau  Xanthobacter autotrophicus
SSDB
Motif
Pfam: ICMT PEMT ERG4_ERG24 ABC_membrane
Other DBs
NCBI-ProteinID: ABS70117
UniProt: A7IQ21
Position
pXAUT01:127698..128372
AA seq 224 aa
MTETPAYGLWGLVILNSVVFILFAASFTRLRTPRDWRTLGAFSAFVVAPFTEMYGFPLTI
YLLSGWLGRQFPGVDFWSHDAGHLLETLFGWRVNPHFGPFHILSTILIFGGFWLLAVSWN
VLYAAQRDHRLATEGPYARVRHPQYAAFVVIMFGFLLQWPTLVTLAIFPILVWVYVRLAR
QEEAAARAEFGPLWDDYARRVPAFLPRIAISSPYVPSSGDGPHD
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaccgaaacgccggcctacggcctttggggcctcgtcatcctcaactcggtggtcttc
atcctgttcgccgcgagcttcacccggctcaggacgccgcgggactggcgcaccctcggg
gcgttctcagcttttgtcgtcgccccgttcaccgagatgtatgggtttccgctgaccatc
tacctcctgtcgggatggctcggccggcagttccccggcgtcgatttctggtcccacgac
gccggtcatctgctcgagaccctgttcgggtggcgcgtgaatccccatttcgggccgttc
cacatcctcagcaccattctgatcttcggcggcttctggctgctcgcggtaagctggaac
gtgctttatgcggcccagcgcgatcatcgccttgcgaccgaaggcccgtacgcgcgggtc
cggcatccccagtacgccgccttcgtcgtcatcatgttcggcttcctgctgcagtggccg
acgctggtcacgctcgccatcttcccgatcctggtctgggtctatgtccgactggcgcgg
caggaggaagcggctgcccgcgccgagttcgggcccctgtgggacgattacgcccggcgc
gttcccgcctttctccctcgtatcgcaatttcatccccatacgtcccttcctccggagac
ggtcctcatgactga

DBGET integrated database retrieval system