KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0158Help
Entry
XACM_0158         CDS       T01616                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00360  Phenylalanine metabolism
xax00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xax00790  Folate biosynthesis
xax01100  Metabolic pathways
xax01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    XACM_0158 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XACM_0158 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XACM_0158 (phhA)
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     XACM_0158 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AEO40468
Position
complement(184356..185246)
Genome map
AA seq 296 aa AA seqDB search
MNTAPQRVENQLTDKGYVPVYTTAVVEQPWDSYSADDHATWGTLYRRQRELLVGRACDEF
LQAQDAMGMGETHIPRFDALNRVLQAATGWTLVGVQGLLPELDFFEHLANKRFPVTWWIR
RPDQIDYIAEPDLFHDLFGHVPLLMNPLFADFMQAYGRGGVKAHGIGPDALQNLTRLYWY
TVEFGLIDTPQGLRIYGAGIVSSKGESLYSLESPAPNRIGFDLQRIMRTRYRIDSFQKTY
FVIDSFAQLMDATAPDFTPIYAELAQQPQVPAGDVLPGDRVIQRGSGEGWSRDGDV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgccccgcaacgcgtcgaaaaccagctcaccgacaaaggctatgtgccggtc
tacaccaccgcggtggtggagcagccgtgggacagctacagcgccgacgaccacgccacc
tggggcaccttgtatcggcgccagcgcgagctgctggtgggccgcgcctgcgacgagttc
ctgcaggcgcaggacgcgatgggcatgggcgaaacgcacatcccgcgcttcgatgcgctc
aatcgcgtgctgcaggcggccaccggctggaccctggtcggcgtgcagggcctgctgccg
gaactggactttttcgaacatctggccaacaaacgctttccggtgacgtggtggatccgc
cggcccgatcagatcgattacatcgccgaacccgatctgttccatgacctgttcggccac
gtgccgttgttgatgaacccgctgtttgccgacttcatgcaggcctatggccgcggcggg
gtcaaggcgcacggcatcggcccggacgcgctgcagaacctcacccggctgtactggtac
acggtggaattcggtctgatcgacacgccacagggcctgcgcatctacggtgccggcatc
gtgtcgtccaagggcgaatcgctgtattcgctggaatcgccggcacccaaccgcatcggg
ttcgacctgcaacgcatcatgcgcacgcgctaccgcatcgacagcttccagaagacctat
ttcgtcatcgacagctttgcgcagctgatggacgccaccgcgccggacttcaccccgatc
tatgccgagcttgcgcagcaaccgcaggtgccggcgggtgacgtgctgccgggcgatcgg
gtgatccaacgcggcagcggcgagggttggagccgcgacggcgacgtgtga

DBGET integrated database retrieval system