KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0198Help
Entry
XACM_0198         CDS       T01616                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00071  Fatty acid degradation
xax00072  Synthesis and degradation of ketone bodies
xax00280  Valine, leucine and isoleucine degradation
xax00310  Lysine degradation
xax00362  Benzoate degradation
xax00380  Tryptophan metabolism
xax00620  Pyruvate metabolism
xax00630  Glyoxylate and dicarboxylate metabolism
xax00640  Propanoate metabolism
xax00650  Butanoate metabolism
xax00900  Terpenoid backbone biosynthesis
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
xax01212  Fatty acid metabolism
xax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XACM_0198
   00630 Glyoxylate and dicarboxylate metabolism
    XACM_0198
   00640 Propanoate metabolism
    XACM_0198
   00650 Butanoate metabolism
    XACM_0198
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XACM_0198
   00072 Synthesis and degradation of ketone bodies
    XACM_0198
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XACM_0198
   00310 Lysine degradation
    XACM_0198
   00380 Tryptophan metabolism
    XACM_0198
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XACM_0198
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XACM_0198
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XACM_0198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xax04147]
    XACM_0198
Enzymes [BR:xax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XACM_0198
Exosome [BR:xax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XACM_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEO40508
Position
230893..232188
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcccgtcccgtcgccattttgggcggcgttcgtatc
ccgttctgtcgtcagaacaccgcgtatgcggatgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgttggtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcattccgcggactggaacctggcgcgcgaggcggcgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtgatcaccatcgccaacaagatcgcgctggggcagatcgactcgggcatcggc
ggcggctctgacaccacctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacgg
ctgctggccgccaaccgtgccaaggccaccggcgacaagctcagggcgctgctgcgcggc
ttcaagctggccgagctcaagcccgaattccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaagacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcttcgcaccataagctggccgctgcctatgagcgcggtttcttc
gactcgctgattgcgccgttccgcggcgtctcgcgcgacaacatcctgcgcgcggacacc
tcgctggaaaaactcgccacgctacgcccggccttcgacaagacctccggccgcggcacg
ttgaccgccgccaattccaccccgctcaccgatggcgccgccgcggtgctgctctccagc
gaagcctgggcgctggcgcatggccacacgccgatggcctacctgcgcgatgcacaggtg
gcggcagtcgacttcgtgcatggcgaaggcctgctgatggcgcccaccatcgcggtgccg
cagatgctggcgcgtcagggcctgaccctgcaggatttcgacatctacgaaatccacgag
gccttcgccgcgcaggtgctgtgcacgctgcgtgcctgggagagcgaggactactgccgc
aaccggctgggcctggacgcgccgctgggccgcatcgacccggacaagatcaatccgctg
ggctcgtcgctggccaccggccatccgttcgccgccactggcgcacgcgtggtggccacg
gccgccaaacagctggaagagcgcggcggcggccgtgcattgatttcgatctgcaccgct
ggcggcatgggcgtggtggcgatcgtcgagcgctga

DBGET integrated database retrieval system