KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0243Help
Entry
XACM_0243         CDS       T01616                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00630  Glyoxylate and dicarboxylate metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01200  Carbon metabolism
Module
xax_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XACM_0243 (aceA)
Enzymes [BR:xax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XACM_0243 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEO40553
UniProt: G2LZR5
Position
277210..278505
Genome map
AA seq 431 aa AA seqDB search
MSTTLQSAEQLQQDWANNPRWSGITRNYSAADVVRLRGTVHVEHSLARLGAEKLWASLHA
TPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNYGMFHLAH
GYARRQMSAFVELQQAEFEAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEAQFHSDKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcactacactgcaaagcgccgaacaactgcagcaggactgggccaacaacccgcgc
tggagcggcatcacccgcaattacagcgctgccgatgtggtgcgcctgcgcggcaccgtg
catgtcgagcattcgctggcgcggttgggcgcggaaaaattgtgggcctcattgcatgcc
acgccgttcgtcaatgcgctgggcgcattgaccggcaaccaggccatgcagcaggtcaag
gccggcttgaaggcgatttacctgagcggctggcaggttgccgccgacgccaatctggcc
gggcagatgtatccggaccaatcgctgtacccggccgattcggtgccggcggtggtcaag
cgcatcaacaacaccttgctgcgcgccgaccagttgcatcacgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggcttcggtggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggcgcggctggcgtgcatttcgaagac
caactggcctcggtcaagaagtgcggccacatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggccgccgatgtgctgggcgtgccgacg
gtactgattgcgcgcaccgacgccgaagccgccgacctgatcaccagcgacgtggatgcc
aacgaccaaccgttcaccactggcgagcgcacggtcgaaggcttcttcaagacccgcaat
ggccttgaccaggcgatcagccgcggcttggcctatgccccgtacgccgacctgatctgg
tgcgaaaccggcaagccggacctggaatttgcgcgtgcgtttgcgcaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaattggaagaagaat
ctggacgatgccaccatcgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggctggcttccacgccttgaactacggcatgttccatctggcgcac
ggctatgcgcgccggcagatgagtgcgttcgtcgaattgcagcaggccgagttcgaggcg
gcggagaggggatttaccgcagtcaagcaccagcgcgaagtaggcaccggttatttcgat
gcagtgacgcaggcgatccagcaggggcaatcgtccaccaccgccttgcgtggctccacc
gaagaagcgcaattccatagcgacaaggcggcctga

DBGET integrated database retrieval system