KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_0469Help
Entry
XACM_0469         CDS       T01616                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00260  Glycine, serine and threonine metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XACM_0469
Enzymes [BR:xax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     XACM_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEO40778
Position
536463..537560
Genome map
AA seq 365 aa AA seqDB search
MDGQGSTTRISFRNDYSEGAHPRLLQALAQASADQHAGYGTDRHTARAVALIRNAVAQPQ
ADVHLLVGGTQTNLIAISAFLRPHQAVIAVDAAHIATHETGAIEATGHKVLTVPALHDKL
TPALIQPVLAVHGNEHMVQPRLVYISNSTESGTLYTRAELEELSGFCRANDLLLYLDGAR
LGAALTADGNDLDLPTIAALTDAFYIGGTKNGALLGEALVIVNPALQPDLRYLIKQRGAL
LAKGMVLGAQFAALFEDGLFFELAAHANAMAQRLRAGLLAAGAHFTSDSPTNQQFIAVSA
QQAAQLAQGYDFERWEVRTDGSQVIRFVTSWATTATAVDRLCADVAALCSTPQCRAMTRP
QGRQR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcagggcagcacgacgcgcatcagctttcgcaacgactacagcgaaggcgcg
catccgcggctgttgcaggcgttggcgcaggccagcgccgatcagcacgccggctacggc
accgatcggcacacagcgcgtgcggttgcgttgatccgcaatgccgtcgcgcagccgcag
gccgacgtgcatctgctggtcggcggcacgcagaccaatctgattgcgatcagcgcgttc
ttgcgcccgcatcaggccgtcatcgcggtggacgcggcgcatatcgccacgcacgagacc
ggcgccatcgaagcgaccggccacaaggtgctcactgtcccggcgctgcacgacaagctg
acgcctgcgttgatccagccggtgctggctgtgcatggcaacgaacacatggtgcagccg
cgcctggtctacatttccaacagcaccgaaagcggcaccctctatacacgtgcagaactc
gaagaattatctggcttctgtcgcgcgaacgatctgctgctgtacctggatggcgcgcgc
ctgggggcggcgctgaccgccgacggcaacgatctggatctgcccaccattgccgcgctg
accgatgcgttctatatcggcggcaccaagaatggtgcgctgctcggcgaagcgctggtc
atcgtcaatccggcgctgcagcccgatttgcgttacctgatcaagcagcgtggcgcgcta
ctggccaagggcatggtgcttggcgcgcaatttgcggcgttgttcgaagatggtctgttc
ttcgaactggccgcgcatgccaatgccatggcgcaacgcctgcgcgccggcctgcttgcg
gcaggcgcgcatttcaccagcgactcgccgaccaaccagcagttcatcgccgtcagcgcg
cagcaggccgcgcagctggcgcaaggctacgacttcgagcgctgggaagtgcgcaccgat
ggcagtcaggtgatccgcttcgtgacctcgtgggcgaccacggccacggcggtcgatcgg
ctgtgtgcggatgtggcggccctttgcagcaccccgcagtgcagggccatgactagacct
caaggacgacaacgatga

DBGET integrated database retrieval system