KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1332Help
Entry
XACM_1332         CDS       T01616                                 

Gene name
thlA
Definition
(GenBank) acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00071  Fatty acid degradation
xax00072  Synthesis and degradation of ketone bodies
xax00280  Valine, leucine and isoleucine degradation
xax00310  Lysine degradation
xax00362  Benzoate degradation
xax00380  Tryptophan metabolism
xax00620  Pyruvate metabolism
xax00630  Glyoxylate and dicarboxylate metabolism
xax00640  Propanoate metabolism
xax00650  Butanoate metabolism
xax00900  Terpenoid backbone biosynthesis
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
xax01212  Fatty acid metabolism
xax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XACM_1332 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    XACM_1332 (thlA)
   00640 Propanoate metabolism
    XACM_1332 (thlA)
   00650 Butanoate metabolism
    XACM_1332 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XACM_1332 (thlA)
   00072 Synthesis and degradation of ketone bodies
    XACM_1332 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XACM_1332 (thlA)
   00310 Lysine degradation
    XACM_1332 (thlA)
   00380 Tryptophan metabolism
    XACM_1332 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XACM_1332 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XACM_1332 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XACM_1332 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xax04147]
    XACM_1332 (thlA)
Enzymes [BR:xax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XACM_1332 (thlA)
Exosome [BR:xax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XACM_1332 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEO41616
UniProt: G2LXB5
Position
complement(1498315..1499490)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAATAIRGALAQSGIAPADISEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAQAAQRSGAFADEIVPVTVTTRKGDVVVDSDEQPGKSDVAKIPTLKPAFKKDGSV
TAASSSSISDGAAITVLMSADDAQRRGVTPLARIVGHVTHAQEPEWFTTAPVAAIQSLVS
KLGWRLDDVDLFEINEAFAVVAMAPIRQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggctcgttcctcggccaa
ttcaacgcggtgccggcacccacgcttgccgcgactgccatccggggcgcgctcgcgcaa
tcgggtatcgcgcctgccgatatttccgaagtcatcgtcggctgcgtgctgccggccaat
ctcggccaggcacctgcgcgccaggccgcgattgccgcaggcattcctacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggaatgaaggcgatcatgttggggcacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gccccgcatctgctgcccaactcgcgcaccggcaaccgctacggcaattttcaggcggtc
gatcacatggcctgggacggtctgaccaatccgtatgacggccaggccatgggcgtgttc
ggcgaagccactgcggagaagttcggcttcagccgcgccgaccaggatgcgttcgccatc
gcctcggtggaacgcgcgcaggcggcgcagcgcagcggcgcgtttgccgacgaaatcgtg
ccggtgacggtgaccacgcgcaagggcgacgtcgtcgtcgacagcgatgagcagccgggc
aagtccgacgtggccaagattccgacgctgaagccagccttcaagaaagacggcagcgtg
accgcggccagttcctcgagtatttccgatggagcggcaatcaccgtgctaatgagcgcg
gacgacgcgcaacgccgtggcgtgacgccgctggcacgcatcgttggccacgtcacccac
gctcaggaaccggagtggttcaccaccgcaccggtcgctgcgatccagtcgctggtcagc
aagctcggctggcgattggacgatgtggatctgttcgaaatcaacgaagccttcgccgtc
gtggcgatggcaccgatcaggcaactcggcatcgcgcacgataaggtcaatgtgcatggc
ggcgcctgcgcattgggtcatccgatcggtgcatccggcgcgcgtttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcaagcgcggaatcgcaacgctatgcatcggcggc
ggcgaagcgaccgccatcgctatcgaattgatttaa

DBGET integrated database retrieval system