KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1732Help
Entry
XACM_1732         CDS       T01616                                 

Gene name
pitA
Definition
(GenBank) Phosphate/sulphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Brite
KEGG Orthology (KO) [BR:xax00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    XACM_1732 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR Pilin_N
Motif
Other DBs
NCBI-ProteinID: AEO42012
Position
1942479..1943606
Genome map
AA seq 375 aa AA seqDB search
MLTLVLVVILAALVFEFINGFHDTANSIATVVATKVLSPGWAVMLAAGMNLIGALTGTAV
ALTIASGLLNTNVVDVTPQVILCALLGGIIWNLITWWKGLPSSSSHALIGGLCGAGLAAA
HNNWDALIWSENIGNWAKNKGLLWKVFVPMITSPIAGFVLGIVVMVLLWAIIAGMSKLGG
PIGRLARPRWVNAFFGKAQIASAAYMGYAHGHNDAQKTMGIIAMTLIGAQSAGALDDLPS
WLSFLHPGTGLAAGAGIPMWIVLTCAVVMAAGTASGGWKIIKTLGHKMVKLHPIHGFAAE
TSSATVLTVAAHFGMPVSTTHSISTAIMGVGFAKNPRSLRLGVIERIVWAWILTIPAAGG
VAYLILTLFELFGWT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaccttagttctggtggtgatcctggccgcgttggtgttcgagttcatcaacggc
ttccacgacaccgccaactccatcgccaccgtggtcgccaccaaggtgctctcgcccggt
tgggcggtgatgctggccgccggcatgaacctgatcggcgcgctgaccggcaccgccgtg
gcgctgacgattgcttccggcctgctcaacaccaacgtggtcgacgtcactccgcaggtg
atcctgtgcgccctgctgggcggcatcatctggaacctgatcacctggtggaagggcctg
ccgtcgtcgtcttcgcatgccttgatcggtggcctgtgcggcgccggcctggccgcggcg
cacaacaactgggacgcgctgatctggtcggaaaacatcggcaactgggccaagaacaag
ggcctgttgtggaaggtgttcgtcccgatgatcacctcgccgatcgccggtttcgtgctc
ggcatcgtggtgatggtgctgctgtgggcgatcatcgccggcatgtccaaactcggcggc
ccgatcgggcggctggcgcgcccgcgctgggtcaatgcgttcttcggcaaggcgcagatc
gcctcggccgcgtacatgggctacgcgcacggccacaacgacgcgcagaagaccatgggc
atcatcgccatgaccctgatcggcgcgcagtcggccggtgcgctggacgatttgccgagc
tggttgtcgttcctgcatccgggcaccggccttgccgccggcgccggtatcccgatgtgg
atcgtgctgacctgcgcggtggtgatggccgcagggacggcgtcgggcggctggaagatc
atcaagacgctcggccacaagatggtcaagctgcatcctatccacggctttgccgcagaa
accagctcggcgacggtgctcaccgtggcggcgcatttcggcatgccagtatccaccacg
cacagcatttccaccgccatcatgggggtgggttttgccaagaacccgcgttcgctgcgg
ctgggggtgatcgagcgcatcgtctgggcctggattctcaccatcccggccgctggcggc
gtggcgtatctgatcctgacgctgttcgagctgttcggctggacctga

DBGET integrated database retrieval system