KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_1786Help
Entry
XACM_1786         CDS       T01616                                 

Definition
(GenBank) Gluconolactonase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00053  Ascorbate and aldarate metabolism
xax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    XACM_1786
Enzymes [BR:xax01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     XACM_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL DUF5122
Motif
Other DBs
NCBI-ProteinID: AEO42063
Position
complement(1992245..1993156)
Genome map
AA seq 303 aa AA seqDB search
MVSTPEHTAVLAVDSRCTHGEGVLWCEQRQALYWVDISEKRLWRHHPAGAQSRYWTLPDR
PGCIGLMHDGRVLVALAKAIGIVDPDTVEEDALPFEKLADVEADNPLTRSNDGRVDRHGN
LVFGTMDEHDSKAARGAFYQFSLKHGLRALPLPGVSIPNSICFGLDGRTMYYCDSVRPQI
LCCDYDPQTAQTTNTRVFTTLDRDDAEPDGSIIDSEGHLWNAQWRASRVVRYRPDGSVER
IVQLPIKHPTCSAFGGAALDRLHVISSRLDHSADELARMPEAGSLFVCDLAIAGLPESRV
ASA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcacgcccgaacacaccgccgtgctggcggtcgacagtcgctgcacgcatggc
gaaggcgtgctgtggtgcgagcagcgccaggcgctgtactgggtcgacatcagcgaaaaa
cgcctgtggcgacaccacccggccggcgcgcagtcgcgctactggacgctgcccgaccgc
cccggctgcatcggcctgatgcacgacggccgcgtgctagtcgcgctggccaaggcgatc
ggcattgtcgatccggacaccgtcgaagaagacgcgctgcccttcgaaaaactggccgac
gtggaagcggacaacccgctcacgcgcagcaacgatggccgcgtcgaccggcatggcaac
ctggtgttcggcaccatggacgagcacgacagcaaggccgcacgcggtgcgttctaccaa
ttttcgctgaagcacggcttgcgcgccctgccgctgccgggcgtttcgatccccaattcg
atctgcttcggcctcgacggccgcaccatgtattactgcgattcggtgcgcccgcagatc
ctgtgctgcgattacgacccgcagacggcgcaaaccaccaacacgcgtgtgttcaccacc
ctcgatcgcgatgacgccgagccggacggctcgatcatcgacagcgaaggccacctgtgg
aacgcgcaatggcgtgcgtcgcgcgtagtgcgttatcgccccgacggcagcgtggagcgc
atcgtgcagctgccgatcaagcatcccacctgcagcgccttcggcggcgcggcactggac
cgcctgcatgtgatcagctcgcgcctggaccatagcgccgacgaactcgcgcgcatgccc
gaagccggcagcctgtttgtctgcgacctcgccatcgcgggcctgcccgaaagccgggtg
gcgagcgcatga

DBGET integrated database retrieval system