KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2183Help
Entry
XACM_2183         CDS       T01616                                 

Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00020  Citrate cycle (TCA cycle)
xax00190  Oxidative phosphorylation
xax00650  Butanoate metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
Module
xax_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xax_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xax_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XACM_2183
   00650 Butanoate metabolism
    XACM_2183
  Energy metabolism
   00190 Oxidative phosphorylation
    XACM_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEO42450
UniProt: G2LTV9
Position
2496675..2497061
Genome map
AA seq 128 aa AA seqDB search
MSRYRTPLKNVRGLGAAKTGTEHFVIQRLTAAALVPLSIWFLIFVLSLIGADHAAATAAV
AKPWNAILLVAFLIASFWHAQLGMQVVLEDYVHDSVLALIAQTLVRFVAVLGAIVSVFAV
ARIALGMS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctaccgtaccccgctgaagaatgtgcgcggcctgggcgccgccaagaccggt
accgaacatttcgtgatccagcgcctgaccgcggccgcactggtgccgctgtcgatctgg
ttcctgatcttcgtgctgagcctgatcggtgccgatcacgctgccgccaccgccgcagtg
gccaagccgtggaatgcgattttgcttgtcgctttcctcattgcctcgttctggcatgcc
cagcttggcatgcaggtggtactggaagactacgtgcacgactcggtgctcgcactgatt
gcgcagaccctcgtgcgttttgttgccgtgctgggcgccatcgtcagcgtatttgccgtg
gcgcgtatcgcgctgggcatgagctga

DBGET integrated database retrieval system