KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2526Help
Entry
XACM_2526         CDS       T01616                                 

Definition
(GenBank) ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00040  Pentose and glucuronate interconversions
xax00053  Ascorbate and aldarate metabolism
xax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XACM_2526
   00053 Ascorbate and aldarate metabolism
    XACM_2526
Enzymes [BR:xax01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     XACM_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEO42786
Position
complement(2905583..2907199)
Genome map
AA seq 538 aa AA seqDB search
MNETNHSIPAAAAEILLAGQWQASRAATGSFRAADPATGEPIGPYFPVSGADDVEAAVVA
AQSVAAELAAVPVERIAAFLEGYADALDADAETLVALAHAETALPAPTRLRGNELPRTSG
QLRQAAQAVRSYSWTQPIIDSAADLRSHLAPLGKPVLVFGPNNFPFAFNAIAGSDFASAI
AARNPVIAKAHPLHPATSQRMAQLAHQALVGAGLPAAAVQLLYHFDTAVGLRLAGDARLG
AIGFTGSRAGGLALKAAADAAGVPFYAELSSVNPVFLLPGALAERGDALAQEFFASCTLG
SGQFCTNPGVVVVPHGAAGEAFIAATKAHFEAAMPMVLFSAAGVEGVQRGVASLRAAGAS
MLAGGHTGEDGYRYAPTLLSVDAQAFLANPHALQAEAFGPVSLLVRAADVAQMAQVAAAF
EGNLTGTLYRAADGSDDAAWQTIAPVLRARVGRLINSKMPTGVAVSAAQNHGGPFPSTGH
PGFTAVGMPGAIRRFAALHSYDAVPDALLPAELRQRNPGGVARLVDGQWSTADLGAGA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacgaaccactccattcccgcggccgcagccgagatcctgctggcagggcaa
tggcaagccagccgcgccgccaccggcagtttccgcgctgccgacccggccaccggcgag
ccgatcgggccgtactttccggtcagtggtgcggacgatgtggaagcggccgtggttgcg
gcgcagtcagtggcggcggagttggcggccgtaccggtcgagcggatcgcggcctttctg
gaaggctatgccgacgcgctggatgccgatgccgagaccctggtcgcgctggcgcatgcc
gagacggcgttaccggcgcccacacgcttgcgcggtaacgaactgccgcgcaccagcggc
caactgcggcaggccgcacaggccgtgcgcagctacagctggacccagcccatcatcgac
agcgcggcagacctgcgttcgcacctggcgccactgggcaaaccggtgctggtgttcggc
ccgaacaactttccgttcgcgttcaatgcaattgccggcagcgatttcgcctcggcgatt
gccgcgcgcaacccggtcattgccaaggcgcatccgttgcatccggccaccagccagcgc
atggcgcagctcgcgcatcaggccttggttggggccggtctgcctgcggcggcggtgcaa
ctgctgtatcacttcgacactgccgtcggcctgcgcttggcgggcgatgcgcggctgggc
gcgatcggtttcactggcagccgtgccggtgggctggcactgaaggcggccgcagacgcg
gcgggcgtgccgttttatgccgagctttccagcgtcaacccggtcttcctgttgccgggc
gcgctggccgaacgcggcgacgcgcttgcgcaggaattcttcgcctcctgcacgctgggg
agcgggcagttctgcaccaaccccggtgtggtggtggtgccgcatggcgcggctggcgag
gcgttcattgcggccaccaaggcgcatttcgaagcggccatgccgatggtgctgttctcc
gccgccggtgtagaaggcgtgcaacgcggtgtggcgagcctgcgtgccgccggcgccagc
atgctggccggcggacacaccggcgaggatggctaccgttatgcgccgaccttgttgagc
gtggatgcgcaagcctttctggccaacccgcacgccctgcaggccgaagccttcggcccg
gtgagcctgctggtgcgcgcagccgatgtggcgcagatggcacaggtggctgccgcgttc
gaaggcaacctgaccggcacgttgtaccgcgcggccgacggcagcgacgatgcggcgtgg
cagaccattgccccggtattgcgcgcgcgggtggggcggttgatcaacagcaagatgccg
accggcgtggccgtgagcgcggcgcagaaccacggcggcccgttcccgagcaccgggcat
ccgggcttcacggcggtgggcatgcccggcgccatccgccgttttgccgccttgcacagc
tacgacgcggtgcccgatgcactgctgcctgccgaactgcgccagcgcaatccgggcggc
gtggcacgtctggtcgatgggcaatggagcacggccgatcttggagccggcgcatga

DBGET integrated database retrieval system