KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3134Help
Entry
XACM_3134         CDS       T01616                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00020  Citrate cycle (TCA cycle)
xax00640  Propanoate metabolism
xax00660  C5-Branched dibasic acid metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
Module
xax_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xax_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XACM_3134 (sucC)
   00640 Propanoate metabolism
    XACM_3134 (sucC)
   00660 C5-Branched dibasic acid metabolism
    XACM_3134 (sucC)
Enzymes [BR:xax01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XACM_3134 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AEO43383
UniProt: G2LQU7
Position
complement(3627560..3628729)
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPAGKVAATPDEAVEVANSLGNGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMSTYQTAGVELPINLVLVTTAGEIVKELYLSILVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHALNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYRLFNEKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKQLVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgttccg
gccggcaaggtcgcggcgaccccggacgaagcggttgaagtcgccaattccctgggcaat
ggcccctggatggtgaaggcgcagatccacgcgggcggccgcggtaaggctggcggcgtc
aagttctgcaagaccacggacgacgtgaaggccgcagccgccaagatgctcggcaccaag
atgtccacctaccagaccgccggcgtcgagctgccgatcaacctggtgctggtcaccacg
gccggtgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctatatcgcctcttccgaaggcggcgtggagatcgagcaggttgcggccgagacg
ccggagctgatccacgcgctcaacgtcgatttcgtcgaaggcgtgcagggttaccacggc
cgcgatttcggcttcaagctcggcctcaacgccaagcaggccggccagttcgccagcatc
atggtgaacctgtatcgcctgttcaacgaaaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtacgcgctggacggcaagttcgacagcgacgac
aacgccgcgttccgtcagaagcagctggtcgccatgcgcgacaagacgcaggaagacgag
accgaagtgaccgcgtcggagttggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgcaggcctggccatggccaccatggacgtgatcaagctcaatggc
ggtgagccggcgaacttcctggacgtgggtggcggtgcgaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgatcgccgaaggcatcatcgccgcggtcaaggaagtgggc
gtcaaggttccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcagctg
ctgcgcgatagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaaa
gtcgttgaagctgtcaagaacgccgcctga

DBGET integrated database retrieval system