KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3452Help
Entry
XACM_3452         CDS       T01616                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00230  Purine metabolism
xax00240  Pyrimidine metabolism
xax01100  Metabolic pathways
xax03030  DNA replication
xax03430  Mismatch repair
xax03440  Homologous recombination
Module
xax_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XACM_3452 (holC)
   00240 Pyrimidine metabolism
    XACM_3452 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XACM_3452 (holC)
   03430 Mismatch repair
    XACM_3452 (holC)
   03440 Homologous recombination
    XACM_3452 (holC)
Enzymes [BR:xax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XACM_3452 (holC)
DNA replication proteins [BR:xax03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XACM_3452 (holC)
DNA repair and recombination proteins [BR:xax03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     XACM_3452 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi Ycf54
Motif
Other DBs
NCBI-ProteinID: AEO43699
UniProt: G2LTK4
Position
4026750..4027175
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANDANLPTLILARDTQQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttctacctgatcgccaagccgcgcttcctcaacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgacgccaacctgcccaccttgatcctggcc
cgcgatacgcagcaggccgaggcgctggacgacctgctgtgggcgttcgacgacgaggcc
tacgtgccgcaccagatcgccggcaccgatgaggaagacgaactggccccggtgctgatt
gccgccccggaattcgccgccccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtactcgaagtcgtgccggccgaccccgctgcccgcgaa
ccgctgcgcgaacgctggaaacagtacaaggccctgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system