KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_4008Help
Entry
XACM_4008         CDS       T01616                                 

Gene name
clpB
Definition
(GenBank) ClpB protein
  KO
K11907  type VI secretion system protein VasG
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XACM_4008 (clpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xax02044]
    XACM_4008 (clpB)
Secretion system [BR:xax02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XACM_4008 (clpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_7 AAA_22 TniB Zeta_toxin NACHT AAA_14 ATPase_2 AAA_18 AAA_25 CbiA Clp_N DUF815 Cyclin_N Hpr_kinase_C
Motif
Other DBs
NCBI-ProteinID: AEO44244
Position
complement(4639620..4642382)
Genome map
AA seq 920 aa AA seqDB search
MAEISRSALFGKLNPLAYRGIESATVFCKLRGNPYVELVHWLHQLLQLQDSDLHRIIKHF
QLNPSTLARDVTSALDALPRGSTAVTDLSANVEEAVERGWVYASLSFGEAQVRTGYLVVG
ILSVRGLRNALLAISKEFDKLKPAVLSEDFARIVAGSPEDGLLPSDGFSLGQTAAPGEAS
GAIAPAALGKQEALKKFTTDLTAQAREGKLDPIIGRDDEIRQVVDILMRRRQNNPILVGE
AGVGKTAVVEGFAQRIARGDVPPALKDVQLRTLDVGLLQAGASMKGEFEQRLRAVIDEVQ
ASPKPIILFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTVGATTFAEYKKYIEKDP
ALTRRFQAVQVDEPDEAKAVRMMRGVASMLEQHHRVQILDEALEAAVKLSHRYIPARQLP
DKSVSLLDTACARVAVSLHATPAEVDDSRRRIESLETEHAIIERERAIGIVVDERAAACA
GLLESEHGRLRDLEQRWFAEKALVDELLSLRAQLRSSNSSMEGTGSALEEEADTDADAAV
AQSASGDTAVLDAPVQVDRDTLLARLQLVQAELAALQGESPLILPTVDYQAVAAVVADWT
GIPVGRMARNEIDTVLRLPDLLAKRVIGQDHAMEMIAKRIQTSRAGLDNPDKPIGVFLLA
GTSGVGKTETALALAETLYGGEQNLITINMSEYQEAHTVSSLKGAPPGYVGYGEGGVLTE
AVRRKPYSVVLLDEVEKAHPDVHELFFQVFDKGWMEDGEGRRIDFRNTLIILTSNAGTDL
IASLCKDPELMPDPDRMAKAIREPLLKVFPPALLGRLVAIPYYPLSNDMLGQIVRLQLNR
IKKRIEERYKIPLEYDDSVVELVVSRCTESESGGRMIDAILTNSMLPDLSKEFLSGLAAS
SKFQRIRVAADKSEFEYFFG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatctcccgcagtgccctgttcggcaagctcaatccgctggcctaccgcggt
atcgagagcgccaccgtgttctgcaagctgcgcggcaacccgtatgtggagctggtgcat
tggctgcatcagttgctgcagctgcaggactcggacctgcaccgcatcatcaaacacttt
cagctcaacccctccacgctggcgcgtgatgtcacgtcggccctggacgccttgccgcgc
ggttccactgccgtcaccgacctgtcggccaatgtcgaagaagcggtggagcgcggttgg
gtgtatgcctcactgagttttggtgaagcgcaggtgcgcaccggctatctggtggttggc
attctgagcgtgcgcggtttgcgtaatgcattactggcgatctccaaggagttcgacaag
ctcaagcccgcggtactcagcgaagactttgcgcggatcgtggccggctccccggaagat
ggtttgctgcccagcgatggtttctcactcggtcagaccgctgcacctggggaggctagc
ggcgccatcgcgccggccgcactgggaaagcaggaagcactgaagaaattcaccaccgac
ctcaccgcacaggcacgcgagggcaagctggacccgatcatcggccgcgacgacgagatc
cgccaggtggtcgatatcctgatgcgccgccgccagaacaacccgatcctggtcggcgag
gccggtgtcggcaagaccgcggtggtggaaggcttcgcacaacgcatcgcgcgcggcgat
gtgccgcccgcgttgaaggatgtgcagctgcgcacgctggatgtgggcctgctgcaggcc
ggcgccagcatgaagggcgaattcgagcaacgcctgcgcgcagtcatcgacgaagtgcag
gccagccccaagccgatcattttgtttgtcgacgaaacccacaccctggtcggcgccggt
ggcgcggccggtaccggcgatgcggccaacctgctcaagcccgcactggcgcgtggcacc
ttgcgcaccgtgggggcgaccacgtttgccgagtacaagaagtacatcgaaaaagacccc
gcgctgacgcggcgcttccaggccgtgcaggtggacgagccggacgaagccaaggcagtg
cgcatgatgcgcggcgtcgcttcgatgctggaacagcaccaccgtgtgcagatcctggac
gaagcgctggaagcggcagtcaagctcagtcaccgctatatccccgcgcggcaactacct
gacaagtcggtgagcctgctcgataccgcctgcgcccgcgtggcggtgagcctgcacgct
acgcctgcggaagtggacgacagtcgccgccgcatcgaatcgctggagaccgaacacgcc
atcatcgagcgcgagcgtgcgattggcatcgtggtggatgagcgtgctgctgcgtgtgcc
ggcttgctggaaagcgaacacggccgcctgcgtgatctggagcagcggtggtttgccgag
aaggcattggtggacgagctgctttcgctgcgtgcacaactgcgtagcagtaattcatcg
atggaaggcaccggcagtgcgttggaagaagaggccgacaccgacgcagatgccgctgtg
gcgcagtcggcgtctggcgacactgccgtgctcgacgcaccggtgcaagttgatcgcgac
acgctgttagcgcgcctgcagttggtgcaggccgaactggcagcattacaaggcgaatcg
ccgctgatcctgcccaccgtcgattaccaagcggttgccgccgtggtcgccgactggacc
ggcatcccggtcgggcgcatggcgcgcaacgagatcgacaccgtgctgcgcctgcccgac
ctgctggccaagcgcgtgatcggccaagaccatgccatggagatgatcgccaagcgtatc
cagaccagccgcgccggtctggacaacccggacaaaccgatcggcgtgttcctgctggcc
ggcacctccggcgtgggcaagaccgaaaccgcactcgcgctggccgaaaccttgtacggc
ggcgaacaaaatctgatcaccatcaacatgagcgagtaccaggaagcgcataccgtgtcc
tcgctcaagggtgcaccgccgggctatgtgggctacggcgaaggcggcgtgctcactgaa
gcggtgcgacgcaagccgtactcggtcgtgctgctggacgaagtggagaaagcccacccg
gacgtccacgaactgttcttccaggtcttcgacaagggctggatggaagacggcgaaggc
cgccgcatcgacttccgcaataccttgatcatcctcaccagcaacgcgggcaccgacctg
atcgccagcctgtgcaaggacccggagctgatgccggatccggacagaatggccaaggcc
atccgcgagccgttgttgaaggtgtttccgccggcattgctcgggcggctggtggcgatt
ccgtattacccgctgagcaacgacatgctcggccagatcgtgcggttgcagttgaatcgc
atcaagaagcgtatcgaggagcgctacaagattccgctcgagtacgacgactcggtggtg
gagctggtggtaagccgctgcaccgagagcgaatcgggtgggcggatgatcgatgcgatt
ttgacgaactctatgttgccggacctctcgaaggaattcctttccggactggcggcgtca
tcgaaattccagcgcataagagttgcggcggacaaaagcgaatttgagtactttttcggc
tga

DBGET integrated database retrieval system