KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_4168Help
Entry
XACM_4168         CDS       T01616                                 

Definition
(GenBank) Membrane-bound lytic murein transglycosylase B
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00010  Glycolysis / Gluconeogenesis
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_4168
Enzymes [BR:xax01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XACM_4168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT_2 Aldose_epim PG_binding_1 PG_binding_3
Motif
Other DBs
NCBI-ProteinID: AEO44399
UniProt: G2M0I0
Position
complement(4853706..4855868)
Genome map
AA seq 720 aa AA seqDB search
MTLARRALPFVLGLLPLAASADPAFDRCLAGLQPQAAAKGVDAASFQRFTAGLAPDPSVL
PLLDAQPEFTTPIWDYLASLVDSQRVSDGQAMLVTHRELLSRLSEQTGVDPATIVAVWGV
ESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSAEGLTGSWAGAFG
QTQFMPSTYARIAVDGDGDGRRDLVTSIPDALASTANYLVKAGWERARPWGMEVTLPRGF
DASKAGRTRRQPLQAWQRAGLLGTDGTPLAPAGLPAETPAALLLPAGASGPAFLVFGNYD
AIYAYNAAESYALSIALLADRLRGGPGLIAAWPTDDPGLGRPERRELQQLLLARGYQIGE
ADGMVGSATRRAIQVEQTRLGLQPADGRPGQRILTALRAAPTVTGAAAMRATAFKLPAAY
PAFAQSPSVHKASPMSDTTGLTTGDFHGFPSLLIDTPFSTAAISLFGGQLLSFVPKGGQD
VMWLSPIAKQPPTPIRGGAPVCWPYFGRQDQTGDVPAHGFVRTVAWQLTESRREDDGTVV
LTLTPPRFDDLALRLRMTLRIGRTLEQRLITENTSAAPVRFTQALHNYFRVGDALKVSVQ
GLDGLDYLDKYENYATVHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPVLGRRVVIA
TEGSRSLVAWNPGEEAGRQMADVGEGWRDYVCLEAANAGPDVIELAPGASHTLTQTISVE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggcccggcgcgcattgccattcgtgttgggactgctgccgctggcagcctct
gccgatccggccttcgaccgctgcctggctggcctgcagccccaggccgctgccaagggc
gtggacgctgccagctttcagcgcttcaccgccgggctggcgcccgatcccagcgtgctg
ccgctgctggatgcgcagcccgaattcaccacgcccatctgggattacctggccagcctg
gtcgacagccagcgtgtcagcgacggccaggccatgctggttacccaccgcgagctgctc
agccgcctgtccgaacagaccggcgtggacccggccaccatcgtggcggtgtggggcgtg
gagagcgattacggccgcgtcaccggcaagcgcccgctgctggtgtcgctggccacgctg
tcgtgcgcgggccgccgccagccgttctttcgcggcgaattcctcgccttgctcagcctg
ctgcagcaaggcgatctgtcggcggaaggactcaccggctcctgggccggtgcgttcggg
caaacccagttcatgccttcgacctacgcccgcatcgccgtggatggcgacggcgacggc
cgccgcgatctggtgaccagcattcccgatgcactggcctccaccgccaactacctggtc
aaggccggctgggaacgcgcccgtccgtggggcatggaagtcaccctgccgcggggcttc
gacgccagcaaggccgggcgcacccgccgccaaccgctgcaggcctggcaacgcgccggc
ctgctcggcaccgacggcacaccgctggcaccggccggactgccggcagaaacgccggcc
gccttgctgttgccggccggtgccagcggcccggcgttcctggtgtttggcaactacgac
gcgatctacgcctacaacgccgccgaaagttacgcgctgtccatcgccctgctcgccgat
cgcctgcgtggcggccccggcctgatcgcggcctggcccaccgacgatccgggcctgggc
cggcccgaacggcgcgaactgcagcagttgctgctcgcccgtggctaccagatcggcgag
gccgacggcatggtcggcagcgccacccgccgcgccatccaggtcgagcagacccgcctg
ggcctgcaaccggccgacggccgccccggccagcgcatcctcaccgcgctgcgcgccgcc
ccgacggtcaccggcgccgccgccatgcgcgccaccgcgttcaagctgccggccgcatac
ccggccttcgcccaatcccccagcgtccacaaggcatcccccatgtccgacaccaccggc
ctgaccacaggcgatttccacgggtttccgtcgctgctgatcgataccccgttctccacc
gccgccatcagcctgttcggcggtcagttgctctcgttcgtgcccaagggcggacaggac
gtgatgtggctctcgcccattgccaagcaaccgcctaccccgatccgcggcggcgcgccg
gtgtgctggccgtatttcggccgccaggaccagaccggcgacgtccccgctcacggcttc
gtgcgcaccgtggcctggcaactcaccgaaagccgccgcgaagacgacggcaccgtggtg
ctcacgctcaccccgccgcgtttcgacgacctggcgctgcgcctgcgcatgaccctgcgc
atcggccgcacgctggagcaacgcctgatcaccgaaaacaccagcgccgccccggtgcgt
ttcacccaggcgctgcacaactatttccgtgtcggcgacgcgctcaaggtcagcgtgcag
ggcctggacggcctggactatctcgataagtacgagaactacgccaccgttcaccgccag
caaggcgactggagcctgcgcgacccacgcgaccccggccgcagcgaccgcatctacacc
aatgccggcggccgctacacgctcaccgacccggtgctcggccgccgcgtcgtcatcgct
accgaaggcagccgctcgctggtggcctggaacccgggcgaagaggccggcaggcagatg
gccgacgtgggcgagggctggcgcgactacgtctgcctggaagcggccaatgccggcccg
gacgtgatcgaactcgctcccggcgccagccacaccctgacccagaccatcagcgtcgag
tag

DBGET integrated database retrieval system