KEGG   Ahniella affigens: C7S18_08370Help
Entry
C7S18_08370       CDS       T05483                                 

Definition
(GenBank) two-component sensor histidine kinase
  KO
K07644  two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC:2.7.13.3]
Organism
xba  Ahniella affigens
Pathway
xba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xba00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C7S18_08370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xba01001]
    C7S18_08370
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:xba02022]
    C7S18_08370
   01504 Antimicrobial resistance genes [BR:xba01504]
    C7S18_08370
Enzymes [BR:xba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     C7S18_08370
Protein kinases [BR:xba01001]
 Histidine kinases
  OmpR family
   C7S18_08370
Two-component system [BR:xba02022]
 OmpR family
  CusS-CusR (copper tolerance)
   C7S18_08370
Antimicrobial resistance genes [BR:xba01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    C7S18_08370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HPTransfase HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AVP97208
UniProt: A0A2P1PQW7
Position
2208901..2210379
Genome map
AA seq 492 aa AA seqDB search
MCWSLRVRRPSLHSSIAWRITLAYTVLAAVVFAMVAIVIHLAVEQHFQGQDRKAWEGKFE
LIGHILDDWRGEQDNAAVFALLSDAMVGHHNLLVRVDDPTANFRFVSGHADIPPLSEARV
SALLPGTFRPIAWSGATAAFQGLTTQLPTGRRGHFMEVTVASDISRHQEILSTFDTQLAL
ICGMALLVMAGLSVVTTRRGLAPIADMAAVAESISAQQLQERLPVQEVPIELRPLAEAFN
GMLDRLSDSLQRLTDFSSDLAHELRTPISNLMMQTQVSLSKRRSEDEYREVLYSALEEYE
DLARMISDMLFLAKADHGLVIPTREQIDLAQEVTAVFEFYDALASERGVRLKHHGQASIQ
GDRVMIRRALGNLLANAIRFTPRGGMIRVDITRSSEAASILVENPGPTIPPEQMVRLFNR
FYRGSASRTRTDEGAGLGLAICQSIVRAHGGDVSVASFAGVTRFVMQFPMELAGLHGEAE
GSEPGPRPRRPH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtgttggagcctccgggtgcggcgcccgtcattgcatagttcgatcgcctggcgcatc
acgctcgcctatacggtgttggcggcggtggtttttgctatggtcgcgattgtgatccat
ctcgccgtggagcagcattttcaaggccaggaccgaaaggcttgggagggcaagtttgag
ctcatcgggcatattttggatgattggcgaggggagcaagataatgctgccgtattcgcg
ttgttaagcgatgccatggtcggccaccataatctcctggtccgggttgacgacccgacc
gccaatttccgattcgtcagtggccacgctgacatcccgcccttgtccgaggcgcgtgtt
tcggccctgctaccgggtacctttcgaccgattgcctggtcgggagcaaccgccgctttt
caaggtctgaccacccaactacccaccggaaggcggggccatttcatggaagtcaccgtt
gcctccgacatttcccggcatcaagaaatcctgtcgacgtttgatacccaactggccttg
atttgcggcatggcgcttctggtcatggcgggtttgtcggtggtgacaacgcgacgtggt
ttggcgccgatcgccgacatggcggcggtggccgaatcgatctcagcgcaacaattgcag
gaacggctgcccgtgcaggaggtgcccattgagctgcggcctttggcggaagcattcaat
ggtatgttggatcgcctcagcgattcactgcagcgactgactgatttttcctctgatctt
gctcacgagcttcgaacgccgatcagcaatctgatgatgcaaacgcaggtcagtctgtcg
aagcggcgcagtgaagacgagtatcgcgaggtgttgtattccgcactggaggagtatgag
gacttggctcgcatgatcagcgacatgctgttcctggccaaagcggatcacggtctggtg
attccgacccgggagcagatcgatctagcgcaggaagtcactgcggtcttcgagttttat
gatgccctggcctcggaacggggcgtgcgtctcaaacatcacggtcaggcgagcatccaa
ggcgatcgtgtgatgattcggcgcgcactgggcaatttgctcgccaatgcgattcgcttt
acgccgcgtggtggcatgattcgtgtcgacatcacacgctcgtctgaggcggcctcaatc
ctggtcgaaaatccgggaccgacgattccgcctgaacaaatggtgaggttgtttaaccgg
ttctatcgcggcagcgcctcgcgcacccgtaccgacgagggggcggggctgggattggcg
atctgccaatctattgtgcgcgcgcatggtggggatgtatcggtggcctcgtttgccggc
gtgacgcgattcgtcatgcagttcccgatggaacttgccggcctccacggtgaggctgaa
ggaagcgaacccggaccgcgtccacggcggccgcactga

DBGET integrated database retrieval system