KEGG   Ahniella affigens: C7S18_09935Help
Entry
C7S18_09935       CDS       T05483                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
xba  Ahniella affigens
Brite
KEGG Orthology (KO) [BR:xba00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xba03016]
    C7S18_09935
Enzymes [BR:xba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     C7S18_09935
Transfer RNA biogenesis [BR:xba03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    C7S18_09935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AVQ00072
UniProt: A0A2P1PYZ6
Position
2586272..2587039
Genome map
AA seq 255 aa AA seqDB search
MLRATDLLYQDDHLVLVNKPAGLVVHRSWMARDVDTTLLEELAPLVPGQLMPVHRLDRAT
SGIMLLARHSQAASLLGKQLMAHGMDKCYLAVCRGWPRSPGEILYDLPDEDGNRKQAALT
CYHTLAQATVPIAVNKYPTQRYALVQVWPKTGRYRQIRRHFHHISHHLIGDTSHGRTEHN
YLFRDHFQCERLLLHAQSLRFKHPESNADLTVAAPLDATFERILATLFPDRIAMQPAPVP
QSQWPRLRPDDAHTG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgcgccacggatctgctctaccaggacgatcacctggttctggtgaacaagccc
gcggggctcgtcgtgcatcgcagctggatggccagagatgtcgataccacattgctggaa
gaactcgccccgttggtcccaggtcagctgatgccggtgcatcgattggatcgcgcgacc
agtggcatcatgctgctggctcggcattcacaagctgcgagtctgctcggcaagcaattg
atggcgcatggtatggacaaatgctacctcgccgtttgccgcggctggccgcgctcgccg
ggcgagattctgtacgatctcccggacgaggatgggaatcgcaaacaggccgcactcacg
tgctatcacacgctcgcgcaggccacggtgccaatcgccgtcaacaagtatccgactcaa
cgctacgccctggtgcaggtttggcccaagacgggccgctatcggcagatccgtcgccat
ttccaccatatctcgcaccatttgatcggtgacacgagccatgggcgaaccgaacacaat
tacttgttccgggatcacttccagtgcgagcggctgttgctacacgcgcagtcgctccga
ttcaagcaccccgaatccaacgccgacctgacggtggcggcgccattggatgcgactttc
gagcggatcctggcgaccttgtttcccgatcgcatcgcaatgcagcccgcacccgtgccg
caatcacaatggccgcggttgcggcctgacgacgcgcacacaggctaa

DBGET integrated database retrieval system