KEGG   Ahniella affigens: C7S18_16110Help
Entry
C7S18_16110       CDS       T05483                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
xba  Ahniella affigens
Pathway
xba03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xba00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C7S18_16110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xba03011]
    C7S18_16110
Ribosome [BR:xba03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C7S18_16110
  Bacteria
    C7S18_16110
  Archaea
    C7S18_16110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AVP98620
UniProt: A0A2P1PUX1
Position
complement(4176066..4176401)
Genome map
AA seq 111 aa AA seqDB search
MEAKAVLRTARISPQKVRLVADLVRGLPVARAESVLKFHNKKAAGIVFKVLHSAIANAEN
NQGADIDELSVTKIFVDEGPVLKRLYARAKGRASRILKRTSHITVVVGTKS
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagctgtactgcgcaccgcgcgcatctcgccgcaaaaggtccgcctggtg
gcggatcttgttcgcggcttgccggtggcacgcgctgaaagcgtgctgaagtttcacaac
aagaaagctgcaggcatcgtgttcaaggtgctgcactctgcgatcgcgaatgcggaaaac
aaccagggtgcggacatcgacgaactgagcgtcaccaagatcttcgttgacgaaggtccg
gtgttgaaacgcctgtacgcccgtgccaagggccgcgcgtcgcgcatcctgaagcgcacc
agccacatcactgtggtcgtcggtaccaagagctaa

DBGET integrated database retrieval system