KEGG   Ahniella affigens: C7S18_20715Help
Entry
C7S18_20715       CDS       T05483                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
xba  Ahniella affigens
Pathway
xba00360  Phenylalanine metabolism
xba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xba00790  Folate biosynthesis
xba01100  Metabolic pathways
xba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    C7S18_20715
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C7S18_20715
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C7S18_20715
Enzymes [BR:xba01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     C7S18_20715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AVP99442
UniProt: A0A2P1PX76
Position
5344041..5344931
Genome map
AA seq 296 aa AA seqDB search
METPRRVEHQMTDKGYVPVYTTAVVEQPWAQYSAEDHQTWATLFKRQQEILQDRACPEFL
ENQAAMGMNESQIPKFDDLNVHLKKATGWKLIAVEGLLPELDFFMHLKNREFPVTWWIRR
PDQIDYIAEPDLFHDLFGHVPLLMNPIFADYMQAYGAGGVRASTFGNEPLSNLTRLYWYT
VEFGLINTPKGLRIYGAGILSSKGESIHCLESNAPNRIGFDLSRVMRTRYRIDTYQKTYF
VIDSFEQLFRATVDPDFGPIYYHLKGAESVPAGTVLDTDTVFNRGTGEGWLTDGDV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaactccccgtcgcgttgaacaccaaatgaccgacaaaggctacgtgccggtgtac
accacggcggtcgtcgagcagccttgggcgcagtacagcgccgaagatcaccagacgtgg
gcgacgttgttcaagcgccagcaagagatcctgcaggaccgcgcctgccccgagttcctg
gaaaatcaggccgcgatgggcatgaatgaatcgcagattcccaaattcgacgacttgaat
gtccatctgaaaaaagccaccggatggaaactgattgccgtcgagggcctgctgccggag
ctcgacttcttcatgcatctgaagaaccgcgagttcccagtcacgtggtggatccggcgt
cccgatcagatcgactacatcgccgaaccggatctgttccatgacctgttcggccatgtg
ccgttgctgatgaacccgatctttgccgattacatgcaagcgtacggcgccggcggtgtg
cgcgcatccacgttcggcaacgagccactcagcaatctgacgcgtctgtactggtacacc
gtggagttcggcctgatcaacacgccgaaaggcctgcgcatctatggcgcgggcatcttg
tcgtcgaagggcgaatcgatccactgcctggaatcaaacgcaccgaatcgcatcggcttt
gatctgtcgcgcgtcatgcgcacgcggtaccgaatcgacacgtatcagaaaacgtatttc
gtcatcgacagctttgaacagctgttccgcgccacggtcgatccggatttcggtccgatc
tactatcacttgaagggcgctgaatcagttccggcgggcacggtcctggacaccgatacc
gttttcaatcgcgggaccggtgagggttggctgactgacggcgacgtgtaa

DBGET integrated database retrieval system