KEGG   Xanthomonadaceae bacterium AQ6-296: ELE36_00595Help
Entry
ELE36_00595       CDS       T06010                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
xbc  Xanthomonadaceae bacterium AQ6-296
Brite
KEGG Orthology (KO) [BR:xbc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xbc03016]
    ELE36_00595
Enzymes [BR:xbc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ELE36_00595
Transfer RNA biogenesis [BR:xbc03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    ELE36_00595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: QBB68996
UniProt: A0A411HET2
Position
123608..124363
Genome map
AA seq 251 aa AA seqDB search
MTATIAAKTAASLEILHEDEHLLAVNKPAGLLVHRSAIASDETDFLVDRLRAQLGSNPFL
IHRLDRATSGVVLLAKNREIAGELGKQFMARTVSKRYLAVVRGWPEESGIIDYPLPDVRD
TSPRKPASTSYRRLATVEVALEMGRYPQQRYALIEAMPETGRYRQIRKHCHHISHHIVGD
TSHGRGDHNRLFRIHYAMHRMLLHAWRLDFIHPVNLLPLQIEAPVDAIWQKILERFAWSD
ALRHAADAASS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacgattgctgcgaagaccgcagcgtcactcgaaattctccacgaagacgaa
catctgctcgcggtcaacaaaccggccggattgctcgtgcatcgcagtgcgattgcgagc
gacgaaaccgatttcctggtcgaccgattacgcgcgcaactcggcagcaatccgttcctg
attcatcgccttgatcgcgccaccagtggcgtggtattgctcgcgaaaaatcgcgagatc
gccggtgagcttggtaaacaattcatggcgcgcaccgtcagcaaacgttatctggcggtc
gtgcgcggctggccagaagaatccggaatcatcgactatccgttgccggatgtgcgcgat
accagcccgcgcaaacctgcaagcacgagttatcgccgcctcgccaccgtcgaagttgcg
ctcgaaatggggcgttatccgcagcagcgttatgcgctgatcgaggcgatgccggagacc
ggtcgttatcggcaaatccgcaaacattgccaccatatttcgcatcacatcgtcggcgat
accagccacggtcgcggcgatcataatcggctgtttcgcattcattacgcgatgcaccgc
atgttgttgcatgcgtggcggctcgacttcatccatccggtgaacttgttgccgctgcag
atcgaagcgccggtcgatgcgatctggcagaaaattctcgaacgttttgcatggagcgat
gcgctgcgacatgcagccgatgcggcaagcagctag

DBGET integrated database retrieval system