KEGG   Xanthomonadaceae bacterium AQ6-296: ELE36_14060Help
Entry
ELE36_14060       CDS       T06010                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
xbc  Xanthomonadaceae bacterium AQ6-296
Pathway
xbc00564  Glycerophospholipid metabolism
xbc01100  Metabolic pathways
xbc01110  Biosynthesis of secondary metabolites
Module
xbc_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:xbc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ELE36_14060 (psd)
Enzymes [BR:xbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     ELE36_14060 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: QBB71386
UniProt: A0A411HLI3
Position
3281163..3282008
Genome map
AA seq 281 aa AA seqDB search
MSPSVLLQYLLPHRALSRLVYWATRWRARWWKNMLIRKIVKSYAVDMSEAAEPDCTAYSS
FNAFFTRALKPGARSIDTDARAVAMPADGCISQLGPIHEGRIFQAKGQDYSATELLADAE
RAAIYRDGSFATIYLSPRDYHRMHMPLSGTLVETVHVPGRLFSVAPFAVEAVPRLFARNE
RLVCHFDSEHGPFAVVLVGAMLVSSVETVWRGLEIPPYSNRIVTRNYQGRGIQLERDIEL
GRFNMGSTVIVLFPAASVTLEPSLQAAQPVRLGQRLGMRNL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagtccatcggttctgctgcaatacctgctgccgcatcgcgccctgtcgcgtctcgtg
tactgggccacgcgctggcgcgcgcgctggtggaaaaacatgctgatccggaaaatcgtg
aaaagctacgccgtcgacatgagcgaagccgccgaaccggattgcacggcttactcgagt
ttcaatgcgtttttcacgcgcgcactgaaacccggggcgcggtcaatcgataccgatgcg
cgagcggtcgcgatgccagccgacggttgcatcagccagctcggaccgattcacgagggc
cggatttttcaagccaagggtcaggactacagcgccaccgaattgctcgcagacgccgag
cgcgccgcgatttatcgtgatggcagtttcgccacgatttatctttcaccgcgcgattac
caccgcatgcacatgccgttgagcggcaccctggtcgaaaccgtgcatgtgcccggacga
ttgttcagcgtcgccccgttcgcggtcgaagcggtgccgcgattgttcgcgcgcaacgaa
agactggtctgccattttgacagcgagcacggcccgttcgctgtcgtgctggtgggtgcg
atgctcgtatcgagcgtcgaaaccgtctggcgcggactcgaaattccgccgtacagcaac
cgcatcgtgacgcggaattatcagggccgcggcatccagctcgaacgcgatatcgaactc
ggccgttttaatatgggctccaccgtgatcgtgttgtttcctgcggcgagcgtcacgctt
gagccaagcctgcaggctgcgcagccggtgcggttagggcagcggctgggcatgcgtaac
ttgtaa

DBGET integrated database retrieval system