KEGG   Xanthomonadaceae bacterium AQ6-296: ELE36_18485Help
Entry
ELE36_18485       CDS       T06010                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xbc  Xanthomonadaceae bacterium AQ6-296
Pathway
xbc00480  Glutathione metabolism
xbc00590  Arachidonic acid metabolism
xbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xbc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ELE36_18485
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ELE36_18485
Enzymes [BR:xbc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ELE36_18485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: QBB72192
UniProt: A0A411HP04
Position
complement(4306894..4307373)
Genome map
AA seq 159 aa AA seqDB search
MSSIYDFSAKTIDGDEQSLAAYKGKTVLIVNVASKCGFTPQYTGLEALYKKYRDQGLVVL
GFPCDQFGHQEPGDEAEIKNFCALTYEVDFPMFAKIDVNGEKTHPLYKFLKSEGKGFLGT
ESVKWNFTKFLIDKNGHVVKRYAPTDKPEKIEKEIAPML
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcatctacgatttcagcgccaagaccatcgatggcgatgagcaatccctcgct
gcctacaaaggcaaaaccgtgctgatcgtcaacgtcgcgagcaagtgtggattcacgccg
caatacaccgggctcgaagcgctgtacaaaaaatatcgggatcaaggattggttgtactc
ggatttccgtgcgaccagttcggccatcaggagcccggcgacgaagccgaaatcaagaac
ttctgcgcgctgacctacgaagtggatttcccgatgttcgccaagatcgacgtcaacggc
gaaaaaacccatccgctgtacaaatttctcaagagcgaaggcaagggatttctcggtacc
gaatcagtgaagtggaacttcaccaagttcctcatcgacaagaacggtcacgttgtcaaa
cgctacgcgccaaccgataaacccgagaagatcgaaaaagaaatcgcaccgatgctttaa

DBGET integrated database retrieval system