KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0122Help
Entry
XBJ1_0122         CDS       T01186                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase, phenylacetic acid degradation (strain W)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00071  Fatty acid degradation
xbo00280  Valine, leucine and isoleucine degradation
xbo00281  Geraniol degradation
xbo00310  Lysine degradation
xbo00360  Phenylalanine metabolism
xbo00362  Benzoate degradation
xbo00380  Tryptophan metabolism
xbo00410  beta-Alanine metabolism
xbo00627  Aminobenzoate degradation
xbo00640  Propanoate metabolism
xbo00650  Butanoate metabolism
xbo00903  Limonene and pinene degradation
xbo00930  Caprolactam degradation
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
xbo01212  Fatty acid metabolism
Module
xbo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XBJ1_0122 (paaF)
   00650 Butanoate metabolism
    XBJ1_0122 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    XBJ1_0122 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XBJ1_0122 (paaF)
   00310 Lysine degradation
    XBJ1_0122 (paaF)
   00360 Phenylalanine metabolism
    XBJ1_0122 (paaF)
   00380 Tryptophan metabolism
    XBJ1_0122 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XBJ1_0122 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XBJ1_0122 (paaF)
   00281 Geraniol degradation
    XBJ1_0122 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XBJ1_0122 (paaF)
   00627 Aminobenzoate degradation
    XBJ1_0122 (paaF)
   00930 Caprolactam degradation
    XBJ1_0122 (paaF)
Enzymes [BR:xbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XBJ1_0122 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 ketoacyl-synt SDH_sah
Motif
Other DBs
NCBI-ProteinID: CBJ79273
UniProt: D3UY95
Position
complement(125205..125978)
Genome map
AA seq 257 aa AA seqDB search
MSHEWILCHQQQRVRTLTLNRPEVRNALSNDCLEQLVQQLEQADADTGTGAIVITGASRY
FAAGADLRELQQQTVATAMTDRRPQLWQRLHNISKPLIAAVNGYALGAGCELVLACDLVI
CGESARFGLPEITLGLMPGAGGTQRLIRCVGKALANQMILTGEAINAQKAQQAGLVSEVC
IDALTLERAEQIAQRISEFSPLALRAAKAALKTAHETSLSQGLLAERQQFVALAGTADRQ
EGITAFLEKRKPTFKGF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgaatggattttatgccaccagcaacaacgggtacgcacactgaccctgaac
cgcccggaagtccgtaatgccctcagcaatgattgtctggagcagctcgtccagcaattg
gaacaggcggatgccgataccggaaccggcgctatcgtcattacaggagcatcacgctat
tttgcggcgggtgccgatctcagggagctacagcagcagaccgttgccacggcaatgaca
gaccgccgcccacaactctggcagcgcttgcacaacatcagcaaacctcttattgcggcc
gtcaatggctacgcactgggtgcaggttgcgaactggtgctggcctgtgatctggtgatt
tgcggtgaaagtgcccgcttcggcctgccggaaattacattgggattaatgccgggcgct
ggcggcacacagcggttaatccgctgtgtgggcaaagcactggccaatcaaatgatccta
actggcgaagcgatcaacgcccagaaagcacagcaggcagggctggtgagcgaagtctgt
atcgatgctctgacattagaacgcgcggaacagattgcccaacgcatcagtgagttttcg
ccgctggcgttacgggcggctaaagctgcactcaagactgcacacgaaaccagcctgtca
caagggctgctcgccgaacgccagcaatttgtcgctctggcagggacagccgatcgccaa
gaaggcattaccgcctttcttgaaaaacgtaaaccaacattcaaagggttctga

DBGET integrated database retrieval system