KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0261
Entry
XBJ1_0261         CDS       T01186                                 

Definition
(GenBank) Hemolysin-coregulated protein Hcp(probable Type VI secreted cytotoxin system component)
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XBJ1_0261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xbo02044]
    XBJ1_0261
Secretion system [BR:xbo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XBJ1_0261
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CBJ79412
UniProt: D3UYN4
Position
complement(268621..269139)
AA seq 172 aa
MPTPCYISINGKTQGNITAGAFTAESVGNIFVQGHEDEMLVQEFDHIVTVPTDPQSGQPS
GQRAHKPFRFTVALNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATI
VDIDCKMPHCQDPSKAEFTQLIRVSLSYRKINWEHTTAGTSGSDDWRAPIVA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatttccatcaatggaaaaactcagggcaatattactgctggt
gcattcactgctgaatcagtaggtaatattttcgttcaaggtcacgaagacgaaatgctg
gttcaagaatttgaccacattgtcactgtcccaactgatccacagtcaggtcagccttct
ggccagcgtgcgcataaaccattccgcttcaccgttgcattgaacaaagccgttcctctg
ctttacaacgcactggcttctggcgaaatgttacctactgttgaattgaaatggtaccgt
acttcaatcgaaggtaaacaagagcatttcttcacgaccaaacttgaagatgcaactatt
gttgacattgattgcaaaatgccacattgccaagatccatcaaaagcagaatttactcaa
ttaattcgtgtgtctctttcttatcgtaagattaactgggaacacactacagcaggtact
tctggttctgatgactggcgtgcgccaattgttgcttaa

DBGET integrated database retrieval system