KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0263
Entry
XBJ1_0263         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein (probable component of the SST VI cluster)
  KO
K11901  type VI secretion system protein ImpB
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xbo02044]
    XBJ1_0263
Secretion system [BR:xbo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XBJ1_0263
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CBJ79414
UniProt: D3UYN6
Position
270061..270558
AA seq 165 aa
MSKNSPGSVAPKERINIKYVPNTGDQTAEVELPLNLLVVGDLKGKKEDTPIEERQTVSVN
KNNFNAVMNEANINLTFNVPNRLDEKNEEDMPVNLEIKSLSDFSPDNIAKKVPELNKLLE
LREALVALKGPLGNIPAFRTRLQSLLDDESVREQLLKELEIVNKK
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagtaagaatagtccaggtagcgtagctccgaaagaaagaattaatattaagtatgtt
ccgaatacgggtgaccagaccgcagaagtcgaattaccgttgaatcttctggttgtcggt
gatttgaaaggaaagaaggaagatacgccaattgaagaacggcaaacagtttcagtcaat
aagaacaatttcaatgccgtaatgaatgaggcgaacatcaatctgacttttaacgtccct
aatcgtcttgatgaaaaaaatgaagaagacatgcctgttaatctggaaattaaatcactg
agtgatttttcaccggataatatcgcaaaaaaagtgcctgaattaaataaacttctggaa
ctgcgtgaggcattggttgcactaaaaggccctctgggaaatatccctgcatttcgtact
cgcttgcagtcgcttctggatgatgaatccgtgcgtgagcaactcctgaaagaacttgaa
atcgtcaataaaaaataa

DBGET integrated database retrieval system