KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0268
Entry
XBJ1_0268         CDS       T01186                                 

Definition
(GenBank) Conserved hypothetical protein with FHA domain (probable component of SST VI cluster)
  KO
K11894  type VI secretion system protein ImpI
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xbo02044]
    XBJ1_0268
Secretion system [BR:xbo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   XBJ1_0268
SSDB
Other DBs
NCBI-ProteinID: CBJ79419
UniProt: D3UYP1
Position
275355..276650
AA seq 431 aa
MEKQQPTLSLRVLNSEQLESGRSASCLFSAQGGTVGSSESHLWSVQDQQGNIHPSQFSVQ
WRDGAFCLQVLAEPVQINNAALTPQSSLIRLQQGDQIKAGNLSIKIHISFSDADRVDPST
VSPESLVSSYSNPLDAMMEGAVVQKAVFADDNSIAPTIQHSFSDDPLRVLDSESLTTLKQ
QVEADDTEQLLPPDHFQSPPFANPISDNRGSVMDQEFLDLPGITSERQYADMDVDHVAIT
PLMRGLDAQLPLHDSQQANDFLQEMGKTMKAAIEGLLALQREQHGLRDKQLRPIEDNPLR
LNMDYDTTMQVMFSDQKSPVHLSAPAAVSESLHNLQLHYQANREAISAALDTMLEAFSPD
QLLRRFSHYRRSNEVRNKDAAWAWEMYTNYYRELASSRQQGFEKLFREVYEQAYDRALRQ
GLEDSSNETFR
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggaaaaacaacaaccaacgctttcattgcgggttctcaacagtgagcaactggaaagt
ggcagatccgccagttgcctgttttcggcacagggcggtacggtcggtagcagtgaaagt
cacctgtggtctgttcaggatcagcagggaaatattcatccatcacaattctccgtgcag
tggcgggatggtgcattctgcctgcaagtactcgcagaacctgtgcagatcaacaatgcc
gcattaacgcctcagtcaagtctgatccgtttgcagcagggagatcagattaaggcgggt
aatctgtctattaagatccacatcagtttttctgatgcagatcgtgttgatccttcgacg
gtatcacctgaatccttggtatcgagttacagcaacccgctggatgccatgatggaaggc
gcagtagtacaaaaagccgtgtttgccgacgataacagtattgctccaacgatccagcat
agtttcagcgatgacccgctcagggtactcgatagcgaaagcctgaccacgctgaagcag
caggttgaagctgatgatactgagcagcttttgccgccggatcatttccaatcaccccca
tttgctaaccctatttctgataaccgaggcagtgttatggatcaggagttccttgattta
ccgggtatcacttccgagcggcagtacgcagatatggatgttgatcatgttgccattacc
cctctcatgcgtgggctggatgcacagttacctctgcatgacagccagcaggctaatgat
tttctgcaagagatgggcaaaaccatgaaagccgccattgaagggttattggctctccag
cgtgaacagcatggactgcgtgataaacaactacgccccatcgaagataaccctctgcgc
ctgaatatggattatgacaccaccatgcaggtgatgttctcggatcagaaaagcccggtt
cacttgtctgcacctgcggccgtctcggaaagtctgcataacctgcaattgcattatcag
gccaatcgggaagccatttcggcagcattggacaccatgctggaagctttctcccctgat
caattgctccgtcgcttctcacattaccgccgcagcaacgaagtcagaaataaagatgcg
gcctgggcgtgggaaatgtacaccaactattaccgtgaattagcttccagccgccagcag
gggttcgaaaagctattccgtgaggtgtatgagcaggcttatgaccgcgcactgcgtcag
ggcttagaggactccagcaatgaaacgttccgctag

DBGET integrated database retrieval system