KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0325Help
Entry
XBJ1_0325         CDS       T01186                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00230  Purine metabolism
xbo00250  Alanine, aspartate and glutamate metabolism
xbo01100  Metabolic pathways
Module
xbo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XBJ1_0325 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XBJ1_0325 (purA)
Enzymes [BR:xbo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     XBJ1_0325 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CBJ79475
UniProt: D3UYU7
Position
335698..336996
Genome map
AA seq 432 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVISIIANGVVLAPDALMKEMNALESRGIPVRERLLISEACPLILPYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAVKLQEIIEYHNFQLVNYYNEP
AVDYQKTLDDILAVADILTNMVVDVSDLLYKATQKGELVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGAGPFPTELFDETGEYLRQKGQEFGA
TTGRSRRTGWLDIVAIRRAIQINSLSGFCMTKLDVLDGLKEVKVCIGYRMPDGSVIDTTP
LAAENWEGLEAVYETLPGWDESTFGVKDHSLLPEAALSYIKRVEELTGVPVDIISTGPDR
AETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaacgttgtcgtattgggcacccaatggggtgacgagggcaagggtaaaatc
gtcgacttgctgactgaacgagctaagtacgtggttcgttatcaggggggccacaatgcg
ggccatacactagtcatcaacggtgaaaaaaccgttctccacttaatcccatccgggatc
ttgcgtgaaaatgtcattagcattatcgcaaatggggtcgttttagcaccagatgctttg
atgaaagaaatgaatgcgcttgaatcacgtgggattcctgtacgtgaacgcctgcttatt
tctgaagcctgtccgttgatcctgccttatcatgttgcactggacaatgcccgcgagaaa
gcgcgtggtgccaaggcaattggtacaactggccgtggtatcgggcctgcatacgaagat
aaagtagcacgccgtggcctgcgtgtaggcgatttgtttgataaagaaactttcgcggtc
aaactgcaagaaatcatcgagtatcacaacttccaactggttaactactacaacgagcct
gctgttgattatcagaaaacactggatgatattctggctgttgcggatatcctgacaaac
atggtagttgacgtttctgatctgctctataaagcaactcagaaaggtgaactggtgatg
ttcgaaggtgcacagggtacgttgttggatatcgaccacggtacctatccttatgtgact
tcttctaataccacagcaggtggcgtcgcaacaggttctggtctggggccacgctacgtt
gactatgttctgggtattatcaaagcctactctacccgtgttggtgcaggtccattccca
actgaactgtttgatgaaaccggcgagtacctgcgtcagaaagggcaggaatttggtgcg
acaactggtcgtagccgtcgtaccggctggctggatatcgttgccattcgtcgtgcgatc
caaatcaactccttgtctggtttctgcatgaccaagctggatgtgcttgatggtctgaaa
gaagtgaaagtctgtattggttatcgtatgcctgatggcagcgtgattgacactacacca
ttggcagcagaaaactgggaaggtcttgaagcagtgtatgaaactctgccaggttgggat
gaaagcacttttggcgtgaaagatcacagcctgctgccagaagcagcactgagctacatc
aagcgtgttgaagaactgaccggcgttcctgttgatattatttctactggtccagatcgt
gctgaaaccatgatcctgcgtgatccatttgatgcttga

DBGET integrated database retrieval system