KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0917Help
Entry
XBJ1_0917         CDS       T01186                                 

Gene name
hisD
Definition
(GenBank) bifunctional HisD: L-histidinal:NAD+ dehydrogenase; L-histidinol:NAD+ dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00340  Histidine metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01230  Biosynthesis of amino acids
Module
xbo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    XBJ1_0917 (hisD)
Enzymes [BR:xbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     XBJ1_0917 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DHDPS
Motif
Other DBs
NCBI-ProteinID: CBJ80058
UniProt: D3UZM9
Position
925690..927006
Genome map
AA seq 438 aa AA seqDB search
MSINFKTVIRWQECPPEQQKALLTRPAVVASENISRTVKQILETVKANGDEALQEFSQRF
DKTTIDTIPLSTSEVNAAASRLTPEIKQAMQQAMNNIRLFHEAQKPAVIEVETLPGVRCQ
QVTRPIDSVGLYIPGGSAPLPSTVLMLGIPAGIAECRNVILCSPPPIADEILYAAQLCGI
NEIFQVGGAQAIAAMAFGTESVPKVDKIFGPGNAWVTEAKRQVSQRFDGAAIDMPAGPSE
VLVIADSGANPAFTAADLLSQAEHGPDSQVVLVTPDEIFAEQVIREIETQLTALPRQQIA
IQALQSSRIIVTDNLTQCVAISNQYGPEHLIIQTRQPEQLVEKITSAGSVFLGDWSPESA
GDYASGTNHVLPTYGYTSTYSSLGLADFLKRMTVQQITPQGLRSLAPIIETLAQAEQLTA
HKNAVTLRIAALNNSDVE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaattttaagaccgttatccgctggcaggaatgcccaccagaacagcaaaaa
gcgttgctgacacgccctgctgtcgtcgcttcagaaaatatttcccgcacggtaaaacag
attctggaaacggtcaaagccaacggcgatgaagcattgcaggaattcagccaacgcttc
gacaaaacaacaatcgatactatcccgctttctacaagtgaagttaacgcagccgccagc
cgcctgacaccagaaatcaaacaggctatgcagcaggccatgaataacattcgcctgttc
catgaagcccaaaaacccgctgtgattgaggttgaaaccctgccgggtgttcgctgccag
caagtcacacgcccaatcgattctgtggggttatatattcccggaggttctgcgcctctg
ccttccactgtattaatgctgggaatacccgctggcatcgcagagtgccgtaacgttatt
ctgtgctccccacccccgattgccgatgaaattctctatgccgcacagctctgcgggatt
aacgaaatatttcaggttggcggcgcacaagccatcgcagcaatggcttttggcacagaa
tccgttcctaaagtggacaagatttttggcccgggtaatgcatgggtaacagaggctaaa
cggcaagtgagtcagcgcttcgacggtgcagccatagatatgccagcaggtccatcagaa
gtactggtaatagcggacagtggagccaatcccgcatttacggcagcagatctgctttca
caagcagagcatggccctgattctcaagtcgtgctggtcacacctgacgaaatttttgcc
gagcaggtgatccgtgaaatcgaaacccaacttacggccctgccacgccagcaaatcgcg
attcaggctctgcaatccagccggattatcgtcactgacaatctgacccaatgtgtagcg
atcagcaatcaatacggccctgaacacttaattatccaaacccgtcagcctgagcagctt
gtggaaaaaatcaccagcgcaggttcggttttcctcggagactggtcgccagaatccgca
ggagactatgcttcaggcaccaatcacgtcttgccgacctatggttatacttcaacctat
tccagcctcggtctggcagatttcctgaaacgaatgacggttcagcaaattacaccgcaa
ggattaagaagcctcgctccaatcatcgaaacactggcgcaggcagaacaactcaccgcg
cacaaaaatgccgtcacattacgcatagctgccctgaataactcagatgttgaataa

DBGET integrated database retrieval system