KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0935Help
Entry
XBJ1_0935         CDS       T01186                                 

Gene name
metG
Definition
(GenBank) methionine tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00450  Selenocompound metabolism
xbo00970  Aminoacyl-tRNA biosynthesis
xbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XBJ1_0935 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XBJ1_0935 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xbo01007]
    XBJ1_0935 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xbo03016]
    XBJ1_0935 (metG)
Enzymes [BR:xbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XBJ1_0935 (metG)
Amino acid related enzymes [BR:xbo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XBJ1_0935 (metG)
Transfer RNA biogenesis [BR:xbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XBJ1_0935 (metG)
 Prokaryotic type
   Other AARSs
    XBJ1_0935 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF5068
Motif
Other DBs
NCBI-ProteinID: CBJ80076
UniProt: D3UX31
Position
946123..948150
Genome map
AA seq 675 aa AA seqDB search
MSQVANKLLVTCALPYANGPIHLGHILEHIQADIWVRYHRMRGKEVHFICADDAHGTPIM
LKAQQSGISPEEMIAKVSLEHQQDFAGFAISYDNYHSTHSEENKELASQIYLKLKKNGYI
KSRKISQLYDPEKGMFLPDRFVKGACPKCKAEDQYGDNCEVCGTTYSPTELINPRSAVSG
ATPEMRDTEHFFFDLPVFSDMLQKWTRSGSLQEQVANKMQEWFDAGLQQWDITRDAPYFG
FEIPDEPGKFFYVWLDAPIGYMGSFQNLCSKRDDLNFDEFWSKDSEADLYHFIGKDIVYF
HSLFWPAMLEGSNYRKPTNLFVHGYITVNGTKMSKSRGTFIKAETYLKHLDADCLRYYYA
AKLSSRIDDIDLNLEDFVQRVNSDIVNKVVNLASRNAGFINKRFAGKLADQLADPALYQQ
FVDAAEGIAEDFTHREFSKAIREIMALADLANRYVDEQAPWVVAKQEGRDADLQAICSMG
INLFRVLMTYLKPVLPSLTDRTEAFLNTELTWDGIRQPLLNHEVSPFKALFNRIEMAKVD
AMVADSKESIEPQKTLTGPLADDPIQDTIAFDDFAKVDLRIALIKQADFVEGSDKLLKLT
LDLGSETRQVFSGIRSAYPDPKALENRLTVMVANLAPRKMRFGISEGMVMAAGPGGKEIF
LLSPDSGAQPGMQVK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtcgcgaacaaattattggtgacctgtgcgttaccttatgctaacggtcca
attcatctcggtcatatcctagaacacattcaggctgatatttgggttcgttatcatcga
atgcgcggcaaagaggttcactttatctgcgctgatgatgcccacggcacaccaattatg
ctgaaagcccagcagagtgggatctcgccagaagaaatgattgccaaagtgagcctagag
catcagcaggattttgccggctttgccatcagctacgataactaccactctacacacagc
gaagaaaataaagaacttgcgtcccaaatttatctgaaactgaaaaagaacggttacatc
aagagccggaagatttctcaactgtacgatccagaaaaaggcatgttcctgccagaccgt
ttcgtcaaaggtgcctgcccgaaatgtaaggccgaagatcagtatggcgataactgcgaa
gtctgcggaaccacttacagcccaacggaattgattaatccccgctcggcagtatccggc
gcgacgccagaaatgcgcgatacagagcacttcttctttgatctgcctgttttcagcgac
atgctgcaaaaatggacgcgttccggctccttgcaagaacaagtcgcaaacaaaatgcag
gaatggttcgacgcgggtctgcaacaatgggatatcactcgtgatgcaccttatttcggt
ttcgaaattcctgatgaaccgggcaaatttttctacgtctggctggatgcgccaattggc
tacatgggctcgttccaaaacctgtgcagcaaacgtgatgacctgaatttcgacgaattc
tggtcgaaagattccgaagcagatctctaccacttcatcggtaaagatatcgtttatttc
catagcctgttctggccagccatgttggaaggcagcaactatcgcaagccgaccaatctg
ttcgtccacggctatatcacggttaacggcacgaagatgtccaagtcgcgcgggacgttt
atcaaagctgaaacgtacctgaagcaccttgatgcagattgcctgcgttattactatgct
gcgaagctctcctcccgtattgatgacatcgatctcaatctggaagatttcgttcagcgc
gttaacagcgatatcgtgaacaaagtggttaaccttgcttcacgtaacgcaggtttcatc
aataaacgttttgcgggcaaactggctgatcaacttgctgatcctgcgctgtaccagcaa
tttgttgatgcggctgaaggcattgcggaagacttcacccaccgtgaattcagtaaggcc
atccgtgaaatcatggcattagccgatttggcaaaccgctacgttgacgaacaggcaccg
tgggttgttgccaagcaagaaggtcgggatgccgatctgcaagccatctgctcaatgggt
atcaacctgttccgcgttcttatgacttacctgaagccggttcttccgagcctgactgac
cgtacagaagcattcttaaataccgaactaacttgggatggcatccggcaaccattgctt
aaccatgaagtttcaccatttaaggcactgtttaaccgtatcgagatggcaaaagttgac
gcgatggtggctgactccaaagaaagcatcgagccacaaaaaaccctgacaggcccactg
gccgatgatcccattcaggacaccatcgcatttgatgattttgccaaggttgacctgcgt
atcgcactgatcaagcaagctgattttgtcgaaggttcagataagctgctgaaactgacc
cttgatcttggtagtgaaacgcgtcaggtcttctccggtatccgttcagcctatccagat
cccaaagcgctggagaaccgtctgacagtgatggtcgccaacctcgcaccacgtaaaatg
cgtttcggcatttctgaaggcatggtaatggctgctggccctggtggaaaagagattttc
ctgttaagcccggacagcggcgcacaaccaggaatgcaggttaaataa

DBGET integrated database retrieval system