KEGG   Xenorhabdus bovienii SS-2004: XBJ1_1498Help
Entry
XBJ1_1498         CDS       T01186                                 

Definition
(GenBank) putative exported protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1525 RPN13_C Fox-1_C Thioredoxin_2 DUF2201
Motif
Other DBs
NCBI-ProteinID: CBJ80626
UniProt: D3V074
Position
complement(1464556..1464954)
Genome map
AA seq 132 aa AA seqDB search
MKKPGLLLLMGWMVSLSAGAKTVIYTDSQHPPVNLPPEAQVIWLDAPEQQQRQIFARLPA
DPQQAATQARTILQSPQWRGQEQQLINAYRAVVHARQAGVRKYPAVVFDDRDVVYGTADV
AKATALREQYQP
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagccgggtttactgctcctgatgggatggatggtatcactgtccgccggagcc
aaaactgtgatctataccgacagtcagcacccgccggttaatttgccccctgaggcacag
gtcatttggctggatgcaccggagcaacagcaaaggcagatctttgcacgccttcccgca
gacccacaacaggcggcaacccaagcccggaccatacttcagtctcctcagtggcgcggg
caggaacagcaacttatcaacgcttaccgtgctgttgtccatgcccggcaagccggtgtg
cgcaaatacccggcggtggtatttgatgatcgtgacgtggtgtatggcacggccgatgtt
gccaaagcgacggcgctcagggagcagtatcagccatga

DBGET integrated database retrieval system