KEGG   Xenorhabdus bovienii SS-2004: XBJ1_1524
Entry
XBJ1_1524         CDS       T01186                                 
Name
(GenBank) conserved hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF87 AAA_10 FtsK_SpoIIIE AAA_29 HerA_C AAA_22 T2SSE
Other DBs
NCBI-ProteinID: CBJ80651
UniProt: D3V099
Position
complement(1485554..1488319)
AA seq 921 aa
MEKLKALNRPGKLREADEAAIYQANPSIIDYLPWVEYLEKEQCLLLDDGISVGAVYQIES
IATEGRPAERLTEIRDQLEDAIQDSLEEDDISPWVVQFFCQDDDDPADYLNTLRGYVKPW
AQGTLFTDAFLTESEYHLNSIARPDGIFQDSLITGQPWRGQQRQTRMVVYRWLPPTRKSR
HDSQTLSAVAALNQVCERLVSSLASAGVIARRQHGGQIHRWLLRHFNPAPDWGMAKADFY
RTVSYEAPIQSDLPVSNDFAESLWFTPPVSDPDAGVWWFDGLPHKAVLVERLRRPPEPGT
LTGEVKRGDNINALMDMMPAGTVVSLTIVAQAQDRLEEDFTRLTKNAVGENTESLRVRQD
VQEVKELLGRRHKLYRSALAFLVRGKDLDDINHRVHQLSSTLLTAGLQPVRPEFSVSPLN
AYLRALPMCFNPQKDKKHGYSRLTWVQHLAGLLPVTGRSTGTGHPGFSFFNRGGAPLTFD
PMNKQDRTQNAHLLLFGPTGAGKSATLCAALIQLMAIHRPRLFIVEAGNSFGLLADYYES
LGLTVNKIGIRPGCGVSLALFADAHQLLQLSPRQLRINEADIPDTDEQQEDEGDEQRDIL
GEMEIAARLMITGGEKREEERLTRSDRGLIREAIMMAAQTSFNEKRQMVASDLQNALYAI
ARNHRQDEHGQPLITAHRRARADEMASAMSMFTQGFEGELFNRPGTPWPEVDVTLIDLGT
LARENYSAQMALAMVSLINKVNNLAERDQYQDRELQLVIDEGHITTTNPLLSPYMTKVVK
MWRKLGAWLWLATQNLADYPDTAEKMLNMAEWWLCLTMPPDEVEQIARFKKLTEEQKAVL
LSASKLPRCYTEGVVLAKKIEALFRVVPPSLYLALGMTEKEEKAERRALMREHQCSELEA
AVLVARKMDIARGLKVDSGSV
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggaaaaactcaaggcactgaaccgccccggcaagctgcgtgaagcggatgaagccgcc
atttatcaggccaatccttctattattgattacctgccctgggtggaatatctggaaaaa
gaacaatgcctgctgctggatgacgggatttccgttggcgcggtctatcagattgaatcc
attgccaccgaaggccgtcccgctgagcggttgactgaaatccgggatcaactggaagat
gcgatccaggacagtctggaagaagatgatatttcgccgtgggtggtgcagtttttttgt
caggatgacgatgatcctgctgactatctcaacaccttgcggggctatgtgaaaccctgg
gcacagggaacactgtttactgacgcctttctgacggaatcagagtatcacctgaacagc
attgcccggcctgacgggatatttcaggacagcttaatcaccgggcaaccgtggcggggc
cagcaacgccagacccgtatggtggtttaccggtggcttccgcccacgcgaaaatcccgc
catgacagccaaactttatcggctgttgccgcccttaatcaggtttgcgagcggctggtc
tcatcactggcttctgccggtgtgattgcccgccgacaacatggcgggcagatccaccgt
tggttgctgcgtcattttaatccggcgccggactgggggatggcaaaagccgatttttac
cgtaccgtcagttatgaagcccctatacaatcggatctccccgtcagtaatgactttgcc
gaaagcctgtggttcaccccgccggtgtctgatcccgacgcgggcgtctggtggtttgac
gggttaccgcataaagcggtgctggttgagcgtctgcgccgtccgccggaaccggggaca
ctgacaggcgaagtgaaacggggcgacaatatcaatgccctgatggacatgatgccggca
gggacggtggtttcgctgaccattgtggcgcaggcacaggacaggctggaagaggatttt
acccggctgacgaaaaatgcggtgggagaaaatactgaatcgctgcgcgtccggcaggat
gtgcaggaagtgaaagaacttctggggcggcggcataaattgtaccgcagtgcgctggcc
tttctggtgaggggcaaggatctggatgatataaaccaccgggtgcatcaattatcctcc
accctgctgacagccggattacagcccgtccggccggaattcagtgtgtcaccgctgaat
gcctacttacgggcactgccgatgtgctttaacccgcagaaagacaaaaaacacgggtac
agccgcctgacctgggtacagcatctggccgggttattgccggtgacaggccgttcgacc
ggcaccgggcatccggggttcagtttttttaaccggggcggcgctccattgaccttcgat
ccgatgaacaaacaggatcgcacccagaatgcccacttattgctgtttggcccgacaggc
gcaggcaaatccgccaccctgtgtgccgcgcttatccagttaatggcgatacaccgaccg
cgcttgtttattgtcgaagccggtaacagttttggcctgctggccgattactacgaaagc
ctggggctgaccgtcaataaaatcggcatcaggccgggctgtggggtcagtctggccctg
tttgccgatgcccatcagctgttgcaactgagtccccggcaattgcgcattaatgaagcc
gatatccccgataccgatgaacaacaagaagatgagggggatgaacagcgcgatatcctg
ggcgaaatggaaattgccgcccgactgatgatcaccggtggtgagaaaagagaagaagaa
cgcctgacccgctctgatcgcggtttaattcgtgaggccattatgatggcggcgcagacc
agctttaacgagaaacgccagatggtggcctcggatttacagaatgccctttatgccatc
gcccgtaatcaccggcaggatgaacacggccagccgttaatcaccgctcaccgacgggca
cgggcagatgaaatggccagcgccatgtcgatgtttacgcaggggttcgagggtgaactg
tttaaccgtcccggtacgccgtggccggaagtggatgtcaccctgattgatttgggcaca
ctggcacgggagaactactcggcgcaaatggcactggcgatggtctcgctgattaacaaa
gtcaataacctggctgaacgggatcaatatcaggatcgcgaactgcaactggtgattgat
gaagggcatatcaccaccaccaatccactgttatcaccctatatgactaaagtggtcaaa
atgtggcgtaaactgggggcctggctgtggctcgccacccaaaacctggcggattacccc
gatactgctgaaaagatgctgaatatggctgaatggtggctgtgtctgaccatgccaccc
gatgaggtggagcaaatcgcccgctttaagaagctgaccgaagagcagaaagcggtgctg
ctctctgccagtaaattaccccgttgttataccgaaggcgtggtgctggcaaagaaaatc
gaagccttattccgggttgtacccccgagcctgtatctggcgctgggcatgacagaaaaa
gaagaaaaagccgaacggcgggcattgatgcgggaacatcagtgcagtgaactggaagcc
gctgttttggtggccagaaaaatggatatcgcacggggattaaaggttgattccggttct
gtatga

DBGET integrated database retrieval system