KEGG   Xenorhabdus bovienii SS-2004: XBJ1_1529
Entry
XBJ1_1529         CDS       T01186                                 

Definition
(GenBank) putative membrane protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: DUF2895 TMEM190
Other DBs
NCBI-ProteinID: CBJ80656
UniProt: D3V0K7
Position
complement(1491317..1491973)
AA seq 218 aa
MSRFRHALKNRDQHILTLRLACGVLVLVLLITLTGWMASPRNLTIHNPPDLRSGSTRPWW
EVPAPSVYSFAFYLFQQLNAWPKNGAQDYPAKIAALSSYLTLACQDFLQADAKTRADSGE
LLDRVRVVYEIPGRGYGAKSVTVRNRDNWVVRLDLVADEYYHAEPVKRALVRYPLKVVRW
EGDAERNPFGLALDCYDGMPQRLEAMPQPLEEKKGVFQ
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagccggtttcgtcatgcgctgaaaaaccgtgaccagcatatcctgaccctgcggctt
gcctgcggggtgctggtactggtcttgctgatcacgctcacgggctggatggcctcaccg
cgcaatcttactatccataatccgccggacttacgcagcggcagcacccgcccgtggtgg
gaagtccctgcgccgagtgtctacagttttgccttttatcttttccagcaactgaatgcc
tggccgaaaaacggggcacaggactacccggccaaaattgcggccttatcgtcttatctg
accctcgcctgtcaggattttttgcaggcggatgctaaaacccgggccgacagtggtgaa
ctgctcgaccgggtgcgggtggtgtatgaaattcccggccggggctacggggcgaaaagt
gtaacggtgcgtaaccgggataactgggtggtgcggctggatttggtggccgatgagtat
tatcacgccgagccggtcaaacgggcgctggtgcgctatcccctgaaagtggtgcgctgg
gagggcgatgcggagcgtaatccttttgggctggcactggattgttacgacgggatgcca
cagcgactggaagcgatgccgcaacctttggaagagaaaaagggggtgttccaatga

DBGET integrated database retrieval system