KEGG   Xenorhabdus bovienii SS-2004: XBJ1_1536
Entry
XBJ1_1536         CDS       T01186                                 
Name
(GenBank) conserved hypothetical protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 CobU AAA_16 AAA_22
Other DBs
NCBI-ProteinID: CBJ80663
UniProt: D3V0L4
Position
complement(1495028..1497091)
AA seq 687 aa
MSRRYVVEALLRPAVELNTALVSAVAAFVCIRAPWAIALAPSVSYVMAGGFTVLAMIRTW
QGIQVIRYRRNLRRLPRYQMSTRHIPVSHRQLFLGRGFRWQQKHTQRLQDTRRPEVERFV
QPSRIYQFARALERRTEYRWPTLSALLRQDSPFNPVRPLPPVGGNPAIHGIEPQEADVFM
DLRERVGHTLVMGTTRVGKTRLAELLITQDIRRGEVVIVFDPKGDADLLRRIWAEAHRAG
RGNELLLFHLGWPEISARYNAVGRFGRVSEVASRLAGQLSGEGNSAAFREFAWRFVNIVA
RALVALGHRPDYQLITRYVNNISELYQRYATRMMEERQPDLLAQINHSLSKLKEKDIPRN
MQGQPDALRLWAMEMTLSSDAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKIAELLSPDYLNMTDLRPIFDWEQVIRKNGIVYIGLDALSDSDVASAVGNSMFADLVSV
AGQIYKYGMNAGLPVRHDGKLAINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSS
DIEARIGSPAKTAQVVGNFNTLMMLRVRDNRTAELLTSQLPEVEIYSKTLVSGHSDIADV
EQGQDFTSSTQDRVGTVKTPLITPAEMINLPKGQAFALLEGGQLWKIRMPLPTGDEDDAL
MPASLQHIAEQMRRHYRTSENWWEEKG
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgagccgccgttatgtggttgaagccctgctgcgtcctgccgtcgagctgaatacggcg
ctggtctccgccgttgccgcgtttgtctgtatcagggcaccctgggccatcgcactggca
ccttccgtcagctatgtgatggccggtggttttactgtattagcgatgatacgcacatgg
cagggtattcaggtcatccgttatcgcagaaacctgcgccgcctgccacgttatcagatg
agcaccaggcacattcctgtcagtcaccggcagttgtttctgggcaggggatttcgctgg
cagcagaagcatacccagcgtttacaggatacccgccgaccggaggtcgagagattcgta
caaccgtcccggatatatcagtttgcccgcgcactggagcgtcgaactgaataccgctgg
ccaacattatcggcgttgttacgtcaggattcgccatttaatcccgtacgcccgctgcct
ccggtgggcggtaatcctgctatccacggtattgagccacaggaggccgatgtttttatg
gatctgcgcgagcgggtcgggcatacgctggtgatgggtaccactcgggtggggaaaacc
cggctggctgaactgcttatcacgcaggatatccggcgcggtgaagtggtgattgtgttt
gatcccaaaggggatgctgacctgttaagacgcatctgggcagaagcacaccgggccggt
cgcggtaatgaattgctcctctttcatctgggctggccggagatttcggcgcgttataac
gccgtcgggcggtttggccgggtatccgaagtggcttcccgtctggccggacagctcagc
ggcgaaggcaacagcgccgcgttccgtgaatttgcctggcggtttgtcaatattgtcgcc
cgtgctttggtggctctggggcaccggccggattaccagctcatcacccgctacgtcaat
aatatcagcgaactgtatcagcgctatgccacccgaatgatggaggaaagacaaccggat
ctgctggcgcaaatcaatcattccctcagcaaactgaaagaaaaagacattccgcgcaat
atgcaggggcaacccgatgccctccggctctgggcgatggaaatgacgctgagttctgac
gcaggcaagcaactctatgacccgattctggatggtctgcgttctgccgtgcgttatgac
cgtacctattttgataaaattgtcgcgtccttattgccgctgctggaaaaactgaccaca
ggcaaaattgccgaactgttatcgccggattacctcaatatgacggatctacggcccatc
tttgactgggagcaggtgatccgcaaaaacgggattgtttatatcggtctggatgcactg
tctgacagtgatgtggcctcagccgtgggcaacagtatgtttgcggatctggtcagtgtc
gccgggcagatttacaaatatgggatgaatgccggattgccggttcgccatgacgggaaa
ctggcgattaatctgcattgtgatgaattcaatgaactgatgggtgatgaatttattccg
ctgatcaacaaaggtggcggcgcggggatgcaggtcacggcgtatacccagacctcttct
gatatcgaagcccgtatcggcagtccggccaaaaccgcgcaggtggtgggtaacttcaat
accctgatgatgctgcgggtgcgggataaccggacggcagaactgctcaccagccagctt
cctgaagtggaaatctacagcaagacgctggtatcgggacattcagatattgctgatgtg
gaacagggtcaggattttacctcttccacgcaggacagggtaggcaccgtcaaaacacca
ctgattactcccgccgaaatgattaacctgccaaaagggcaggcattcgcgttactggaa
ggcgggcaattgtggaaaatccgcatgcctttgccaacgggggatgaggatgatgccctg
atgccggccagtttgcagcacattgccgaacagatgcgcaggcactaccgcaccagtgaa
aactggtgggaagagaagggatag

DBGET integrated database retrieval system