KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2100Help
Entry
XBJ1_2100         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein (probable component of SST VI cluster)
  KO
K07169  FHA domain-containing protein
Organism
xbo  Xenorhabdus bovienii SS-2004
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    XBJ1_2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: CBJ81226
UniProt: D3V3B1
Position
complement(2059923..2061476)
Genome map
AA seq 517 aa AA seqDB search
MRFTIVKNIGTSQPQQLSYDFMPPGGTIGRSPDNNWILPDEGQAIARLQATVSVSIDGEC
RMTNRGAASDILLNTIPIAPDRRIEIRDGDTLNIGDYQIQVININQGSNNTNSVNTPPLT
TIRKDIPSEIWDGLENTFTPDESMPQTPQQVAKTLNDNNPLIKPQRHQERNPINPLEQME
TIIDLDSLQHRATDPITMFNANTDSQQENILNDSTPSTLLQQGNQRDKPEIDPLILFSDK
HRRGILHDEPLNWVMENAEPLVAQANTGSSDPQYGASDPPFHRHNNEHLDIDPVTYPPNP
HQPDQAEEGVKLEGQLLAALLEGMGLNHLQNLQFDGHTLYKLGKLLSQLSQGIIALNASR
TQLKYETDTGVAQILVDGNNPFALFPSGQAVLIQMIGEHMPGFMSAEQATRDILIELQAH
QLGMIAGLRTITAEMLQRFDPLVVKQKAQAAGRLPRLALSSTYKAALWDYFTKHYQKNME
KIEQDHTIFGEQFRQAYESEIIRYKHSQDKLKNKDKK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcaccattgttaaaaatattggtacaagccagccgcaacaactgagttatgat
tttatgccacccggtggcacaattggccgctccccagataataactggattttgcccgat
gaagggcaggctatagctcgtttacaggccactgtatctgtttccatcgatggagaatgt
cgtatgaccaatcggggggctgcctctgatattttgttaaataccatccccatcgctccc
gaccggaggattgaaatacgcgatggtgatacgttaaatatcggtgattaccaaatccaa
gtcattaatattaaccaaggttcgaataatacgaatagtgtgaacacgccaccattgaca
acaattcgcaaagatattcccagtgaaatttgggatggattggagaacacgtttacgccc
gatgaaagcatgcctcagactccccaacaagttgctaagacactcaatgacaataatcca
ctcataaaacctcagcggcatcaggaacgtaatccaataaaccctctcgaacagatggaa
acaataattgatctggattccttgcaacaccgtgccacggatccaatcacgatgtttaat
gcaaacacggatagccagcaggaaaatattctcaatgacagtacgcccagtaccttattg
cagcagggcaatcagcgcgataaaccagaaattgatcccctgattctattttccgataaa
catcggcgggggattttgcatgatgagccgctaaattgggtaatggagaatgctgaacct
ttggtcgcacaggctaatacaggctcttctgaccctcaatatggtgccagtgatccccct
ttccaccgtcataacaatgaacacttggatatcgacccagtgacatatccgcctaatccc
catcaacccgatcaggccgaagaaggtgttaaattagagggtcaactcttagccgcttta
ttggagggtatggggcttaatcatctccaaaacctgcaatttgatgggcataccctgtat
aaactggggaaattacttagccagttatcacaaggcattatagcgttaaatgcgtcacgc
acacagttgaaatatgagactgataccggagttgcccagattctggtggatggcaacaat
ccctttgcactttttccttcgggtcaagcggtgctgatccaaatgattggcgaacatatg
ccaggatttatgtcagcagaacaggcaacacgagatattttaatcgagttacaagcacat
caattgggtatgattgccggtttacgcactattacggcagagatgttacaacgatttgat
cccttagtggttaaacaaaaagcacaagctgccggcagactgcctcgtttggcattatca
tcaacgtataaagctgctttatgggactatttcaccaaacattatcagaaaaatatggaa
aaaattgaacaggatcacactatatttggtgaacagtttcggcaagcctatgagtcagaa
attatccgatataaacactcacaagataaattaaagaacaaagataaaaaataa

DBGET integrated database retrieval system