KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2105
Entry
XBJ1_2105         CDS       T01186                                 

Definition
(GenBank) Conserved hypothetical protein (ImcF domain protein precursor of SST VI cluster)
  KO
K11891  type VI secretion system protein ImpL
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XBJ1_2105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xbo02044]
    XBJ1_2105
Secretion system [BR:xbo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XBJ1_2105
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C MMR_HSR1 Wzy_C FeoB_N
Other DBs
NCBI-ProteinID: CBJ81231
UniProt: D3V3B6
Position
complement(2065703..2069218)
AA seq 1171 aa
MLSAIVAIFTSRLMWSFLGITAISSIIWFIGPMTSIGNTIPLGSSTVRIIIIAILYFVWL
FIQLASHLYQVWLNKKLSAPLNRGNDEGEQVRNSQYSPLSEHFSDALRLLKNAYFYGSEI
QYKPKWKPFFDRRYRYQLPWYVLIGPPNSGKTTLLANSGLHFPLSDHFETLSSNEIKETD
NCHWWFTNQAVLLDTPGRYTTQDTRHEQDAREWKCFVNLLKKYRTRQPLNGVILTISVAD
LLNPSKKVRDQHAYLLRRRLSELQAQFKIQFPIYVIITKIDLLKGFGAYFAHFDKTQRDQ
IWGFNFPWNKTGWDLKDIFAQQYGLLQTRLNAELSHILLHLNDLQQCAESYLFPQEFAAL
QPLIAQHLEIAFAKSGFDIPYSPRGLYFTSSVQEEPIHQGYFLKTLLETLFQEAGLAGQN
RWWVYRNRLLKGLGYIILAAIMGLIITLFFSSYGNNKNYLTEVQNKIFPILSQSAALKKI
SNDIDIYALLPILNKVADLGKSKYFSPDAPPWSYQMGLYHGEQINDASLTLYTKTLQTLL
LPQVARLITSQLHQTNSDNIYNTYNTLKAYQMLCQPQHYDGKFLHRWVMQYLQAHLPPTI
SPTQLHQIEGHLRQLLEYQIVTFPYVCDNPLIKQKQILLSKIPLAQLVYIHLKQELSDNP
NLSPVGLTTLAGPEAGLVFSRINGTPITLNIAGMFTPAGYQMGIGNNLTTLIDKLYSQNA
WILGQYAEISTPRELTLLVRQFYLHDYLEQWDKFLFDIRLNNIDSLEQRSNIAQFLASNA
SPMRNLLINISKNVNLDERLSDNHFDKKIGELVSRKADSLTKVVPNPFMSGDNLPTPEQE
LRKHFAQITALANNPDGKNKQIPFDHVLSQLAKLHEYLDSVQNATNIGIPAPSDEIITQL
QATAERLPIPFKGIISSLAMGANSDTQASNVKNLNKQLNTEVQGFCHQAIANRYPLTPWA
LDDIRPDDMARMFAPQTGIMDSFFQKNLVGKVDTSHENWRLILGTDSKAKALPESHKLLL
PFQQAQIIRDTLFSDGSRIPSFRVIVRTVNMDKEILSMILDVDGQQLQYSHGPQVSQSLN
WPGPNGSNQARIQLNLDDGTTASLITSGPWALNRLIDHEQFAAGKPATNNHTSQRVTFNI
RGHHVSLEFIPNSILSPFQLPIFVCPKLINS
NT seq 3516 nt   +upstreamnt  +downstreamnt
atgttgagcgccattgttgctatttttaccagccgattaatgtggagtttcctcggcatc
accgccatctcttccattatctggtttattggtcccatgacttctatcggtaataccata
cctcttggatcaagtacggtacgaataattatcattgccatattatattttgtctggctc
tttatccagttagcgtctcacttatatcaggtttggctgaataaaaaactttctgcccca
ttaaacagaggcaatgacgagggtgaacaagtacgaaattcacaatattcccctttatca
gaacacttttctgatgccttacgactactgaaaaatgcctatttttatggttcagagatc
caatataagccaaaatggaaaccttttttcgatcgtcgatatcggtatcagttaccttgg
tatgtcctgattggcccccccaattcagggaaaacaacccttctggcaaattctggtttg
cactttccattatccgatcatttcgaaacgctttcctcaaacgagataaaagaaaccgat
aattgtcactggtggttcaccaatcaggctgtcttactggatacacccggacgatatacc
actcaggatacacggcacgaacaagatgcccgtgaatggaaatgttttgtcaatttgctg
aaaaaatatcgcacacgccagcccctaaatggcgtcattcttaccattagcgtagcggat
ttattaaacccctcaaagaaagtacgtgatcaacacgcttatttattacgcaggcgattg
tcagaattacaggctcagttcaagatccaatttccaatctatgtcatcattaccaagatt
gatttactgaaaggatttggggcttattttgcccattttgacaaaacacagcgcgatcaa
atctggggattcaatttcccgtggaacaaaacaggctgggatctgaaggacatttttgca
cagcaatatgggttgttgcagacacgattaaatgcagagctatcccatattttattgcac
ctgaatgatcttcagcaatgtgctgaaagttacctgtttccgcaagaatttgccgcactg
caacccttaattgctcagcatcttgaaattgcattcgctaaatcagggtttgatattcct
tattcaccacgtgggctttatttcactagcagcgtacaggaagagcctattcatcaagga
tattttctgaaaactctgctggaaacgctctttcaggaagcggggcttgccggtcaaaat
cgttggtgggtgtacagaaaccgtctattaaaagggctggggtatattattctggctgcg
atcatggggttaatcatcaccttgttttttagcagttatggcaacaataaaaattacctg
acagaagttcaaaataaaattttccctattctgagccaaagtgcagcattaaaaaagatc
agcaacgacatcgatatttatgccttactgcctattttgaataaagtggcggatttggga
aaaagtaaatatttttctcctgatgctcccccttggtcataccaaatgggcttgtatcat
ggtgaacagatcaatgatgccagtttgactctgtacacgaaaacattacaaaccttattg
ctaccgcaagtcgcacggttaataacgtctcaattgcaccaaaccaacagcgataatata
tataacacttacaatacgttgaaagcgtatcaaatgttatgtcagccccaacattatgac
ggtaagttcttacatcgttgggtgatgcaatatttgcaggctcatttaccccccactatt
tcaccgacacaattacaccaaattgaggggcatctgcgccaattattggaatatcagatc
gttactttcccttatgtttgtgataacccactgataaaacaaaaacagattttacttagc
aagatcccactagcacaactcgtttatatccatttaaaacaggaactatcggataacccc
aatttatcgccagtcggcttaacaacgcttgctggcccagaagccggattggttttctca
cgcatcaacggtacaccgattacccttaatatagcggggatgtttactccggcggggtat
caaatggggataggtaacaatctcactaccctcatcgataagttatacagtcaaaatgca
tggatactgggccagtatgcagaaatatcaaccccaagagagcttaccctcttagtacga
caattttatctccatgattatcttgaacaatgggataaatttctgttcgacatccgtcta
aacaatattgacagcctggagcagcgttctaatatagcccagtttctggcttcaaatgct
tctcccatgcgcaatctgctcattaatatcagtaagaatgtcaatctggatgaaaggtta
agcgataaccattttgataaaaaaatcggtgagttggtcagccgtaaagcagattcattg
acaaaagtcgtacctaatccattcatgtcaggagataacctccccaccccggaacaagaa
ttgagaaaacattttgcccaaattactgcattggcaaacaatccagacggtaaaaataag
caaattccttttgatcatgttctcagtcaacttgccaaattacacgaatatctggattca
gtacaaaatgctaccaatataggcatacccgcgccatcggatgaaattatcacccaactc
caagccacggcggagcggttgccgatcccattcaagggcatcatttcctcgttggcaatg
ggggctaacagtgatacacaagccagtaacgtaaagaatctcaataagcagctgaataca
gaagtccaaggcttttgtcatcaagcgattgccaaccgctatccgctgacgccgtgggca
cttgatgatatcagaccggatgatatggctcggatgtttgcgccacaaacggggatcatg
gatagctttttccaaaaaaatctggtgggaaaagtcgatacatctcacgaaaactggcgc
cttatactgggaacggatagcaaagcaaaagcattaccggaaagtcacaagttactcctg
ccattccaacaagcccagatcattcgagatactttattcagcgacggctcgcgtatccct
tcatttcgggtcatcgtccgcaccgtaaatatggataaagagatattgagtatgatactg
gatgttgatggtcagcaattgcaatatagccacggcccacaagtttcgcagtcactcaat
tggcctggcccaaacggctccaatcaggctcgtatccaattaaatttagatgatgggaca
acagcgagtctcatcacttccggcccgtgggcattaaatcgcttaattgaccatgaacaa
ttcgcggcaggaaaacccgccacaaataatcatacaagccagcgtgtgacatttaatatc
agaggccatcatgtctcattggaatttattccaaacagtattctcagcccgtttcaactt
cccattttcgtctgtcccaagctgattaattcataa

DBGET integrated database retrieval system