KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2108Help
Entry
XBJ1_2108         CDS       T01186                                 

Definition
(GenBank) conserved protein of unknown function (putative lipoprotein of SST VI cluster)
  KO
K11906  type VI secretion system protein VasD
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xbo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XBJ1_2108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xbo02044]
    XBJ1_2108
Secretion system [BR:xbo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XBJ1_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN DUF2498
Motif
Other DBs
NCBI-ProteinID: CBJ81234
UniProt: D3V3B9
Position
complement(2071856..2072365)
Genome map
AA seq 169 aa AA seqDB search
MVILFLHVLVFNLIIFNIFVLTGCSSSEQKKSPPYQLIFRATNNVNDSAPLKIHVILLKS
TSEFMSADFFSLQGHAQAVLGNKLINSEQLFLLPFQHKYFLLEKNIPEANSIGIFAEYKQ
LDGKKWRIALPVPIPEPPAFYKFWTSPPDTLDICIQVTANGLNFIDKCN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggtaatactgtttcttcacgtactcgtatttaatttaataatatttaacatcttcgta
ttaacagggtgttcatcatccgagcagaaaaaatcgcccccttatcaattgatttttcgt
gccacaaataatgtgaatgactcagctccgctgaaaatacacgttattttgttgaaatcg
acttcagagtttatgtctgctgattttttttcactgcaaggtcatgctcaggctgtactg
ggtaataaattgattaattctgagcaactttttttactgccttttcagcacaaatatttc
ttgttggaaaaaaacataccagaagccaattctatcggcatttttgctgaatataagcaa
ttggatgggaaaaaatggcgtatcgcattaccggttcccattcctgagcctcccgctttc
tataaattttggacatcaccgccagacacattagatatatgcattcaagtcaccgccaat
ggcctaaatttcatcgataaatgcaattaa

DBGET integrated database retrieval system