KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2199Help
Entry
XBJ1_2199         CDS       T01186                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00900  Terpenoid backbone biosynthesis
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XBJ1_2199 (ispE)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     XBJ1_2199 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBJ81325
UniProt: D3V152
Position
complement(2180959..2181837)
Genome map
AA seq 292 aa AA seqDB search
MTLTWPSPAKLNLFLYITGQRSDGYHELQTLFQFLDYGDEITITPRQDNQIHLLTPVEGV
AHDNNLIVRAARLLQDHLLQNNNKGTQHLGADIHIDKCLPMGGGLGGGSSNAATVLIALN
YHWQANLSDDELAQLGISLGADVPVFIKGHAAFAEGIGEKLRPASPEEKWFLVAHPGIEI
STPTIFTDPELKRNSPIRSLPALLQAPFTNDCESIARKRFRKVEQLLSWLLEYAPSRLTG
TGACVFGEFESEASARKVLNQSPEWMQGFVARGVNISPLHTFRSGIYMLLNQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgacttggccttccccggcaaaattgaatttattcttgtatattactggccaa
cggtctgatggctaccacgaactgcaaacgctgttccagtttcttgactatggcgacgag
atcacgattaccccccgtcaggataatcaaatccacctgctgacgcccgttgaaggcgta
gctcatgacaataatctgatcgtccgggctgcccgattattgcaggatcatttattacag
aataataataagggaacccaacatctgggcgccgatatccacatcgacaaatgcctgcca
atggggggaggtctgggtggtggttcttctaatgccgcgacagtactgattgccttgaat
taccactggcaagccaacttgtccgatgatgaacttgcacagcttggtatcagccttggt
gcggacgttcccgtatttattaaaggccatgccgcttttgccgaaggcattggggaaaaa
ctccggccggcatcaccggaagaaaagtggtttctggttgctcatcccggaattgagatt
tcaacgccgacgatcttcacagatcctgaattaaaaagaaattctccgattcgttctcta
cccgcattattacaggcaccatttacaaatgattgtgaatcaatcgcaagaaaacgtttt
cgtaaggttgaacagcttctttcatggctgctagaatacgcaccgtcgcgcctgaccgga
accggtgcgtgtgttttcggcgagttcgaatcagaagcatcggcccgtaaggtgttaaat
caatccccagagtggatgcagggctttgttgcgcgtggagtcaacatttcaccattgcat
acattccgctctgggatatacatgttattgaaccaatga

DBGET integrated database retrieval system