KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3384
Entry
XBJ1_3384         CDS       T01186                                 

Definition
(GenBank) PilL protein (fragment)
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Other DBs
NCBI-ProteinID: CBJ82502
UniProt: D3V4C3
Position
3298328..3298864
AA seq 178 aa
MRITVLMGVLVTILTGCNAPSNKPPSQCASEKAISATQLTRNIQPVSPDIYQQAPEVVRY
GRYILVSTDPTAAQRDPLSQLIEVHIPASQHPTVADALRDVLRQSGYRLCAPEKTNDILY
RQPLPSVHYQLGPVRLRTALQLMAGPAWQLEVDEVQREVCHHLRPGYQLPQPRQGKQP
NT seq 537 nt   +upstreamnt  +downstreamnt
atgagaataaccgtattaatgggtgtattggtcactatcctgacgggttgcaatgccccg
tcaaataaaccgccgtctcaatgtgcttccgaaaaagccatttcagcaacgcagctcacg
cgcaatattcagcccgtctcacccgatatttatcaacaagcgccggaagtagtccgttac
ggtcgttatatcctggtaagtaccgacccaacagcagcacagcgtgatccgctttcccaa
ttgattgaggttcatattccggcgtctcagcatcccacggtagccgatgccctgcgtgac
gtattacgccagtcgggttatcggttatgtgcgcctgaaaaaaccaatgacattttatat
cgccagccgttgccgtctgtgcactatcagttaggccctgtccggctgcgtaccgctttg
cagcttatggcaggcccggcctggcaactggaggtggatgaggtgcaacgtgaggtttgt
caccatttgcggccgggttatcagcttccacaaccccggcagggaaagcagccatga

DBGET integrated database retrieval system