KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3387
Entry
XBJ1_3387         CDS       T01186                                 
Name
(GenBank) putative plasmid transfer protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 CobU AAA_16 AAA_22
Other DBs
NCBI-ProteinID: CBJ82505
UniProt: D3V4C6
Position
3300074..3302137
AA seq 687 aa
MSRHYVVEALLRPAVELNTAVVSVVAAFVCIRAPWAIALAPSVSYVMAGGFAVLAMIRTW
QGIQVIRYRRNLRRLPRYQMSTRQIPVSHRQLFLGRGFRWQQKHTQRLQDTRRPEVERFV
QPSQAYQLARALERRTEYRWPALSALLRKDSPFNPVRPLPPVGGNPALHGIEPQETDVFM
DLRERVGHTLVMGTTRVGKTRLAELLITQDIRRGEVVIVFDPKGDADLLRRIWAEAHRAG
RGNELSLFHLGWPEISARYNAVGRFGRVSEVASRLAGQLSGEGNSAAFREFAWRFVNIVA
RALVALGHRPDYQLITRYVNNISELYQRYATRMMEERQPDLLAQINHSLSKLKEKDIPRN
MQGQPDALRLWAMEMTLSSDAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKIAELLSPDYLNMADLRPIFDWEQVIRKNGIVYIGLDALSDSDVASAVGNSMFADLVSV
AGQIYKYGMNAGLPVRHDGKLAINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSS
DIEARIGSMAKTAQVIGNFNTLIMLRVRDNRTAELLTSQLPEVEIYSKTLVSGHSDIADV
EQGQDFTSSTQDRVGTVKTPLITPAEMINLPKGQAFALLEGGQLWKIRMPLPTGDDDDAL
MPANLQNIAEQMRRHYRTSENWWEEKG
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgagccgccattatgtggttgaagccctgctgcgtcctgccgtcgagctgaatactgcg
gtggtctcagtcgttgcggcttttgtctgtatcagggcgccttgggccatcgcactggca
ccttcagtcagctatgtcatggcaggcggttttgccgtactggcaatgatacgcacatgg
cagggtattcaggtcatccgttatcgcagaaacctgcgtcgcctgccacgttaccagatg
agcaccaggcaaattcccgtcagtcaccggcagttgtttctgggcaggggatttcgctgg
caacagaagcatacccagcgtttgcaggatacgcgacgaccggaggtcgaacgatttgtg
caaccgtctcaggcttatcagcttgcccgcgcactggagcgtcgaactgaataccgttgg
ccggcattatctgcgctattacgcaaagactcgccatttaatccggtacgtccgctgcca
ccagtgggcggtaatccggcactccacgggattgaaccacaggagactgatgtttttatg
gatctgcgcgaacgggtcgggcatacgctggtgatggggactacccgtgtgggaaaaacc
cggctggctgaactgcttatcacgcaggatatccggcgcggtgaagtggtgatcgtcttt
gatcccaaaggcgacgctgatctgttaaggcgcatttgggcagaagcgcaccgcgcgggt
cgcggcaatgaactgtccctctttcatctgggctggccggagatttcggcgcgttataac
gccgtcgggcggtttggccgggtgtccgaagtggcttcccgtctggccggtcagctcagc
ggcgaaggcaacagcgccgcgttccgtgaatttgcctggcggtttgtcaatattgttgcc
cgagctttggtggctctggggcatcggccggattaccagctcatcacccgctacgtcaat
aatatcagcgaactgtatcagcgctatgccacccgaatgatggaggaaagacagccggat
ctgctggcgcaaatcaatcattccctcagcaaactgaaagaaaaagacattccgcgcaat
atgcaggggcaacccgatgccctccggctctgggcgatggaaatgacgctgagttctgac
gcaggcaagcaactctatgacccgattctggatggtctgcgttctgccgtgcgttatgac
cgtacctattttgataaaattgtcgcgtccttattgccgctgctggagaaactgaccaca
ggcaaaattgcggaattattgtcaccggattatctcaatatggcggatctgcgtcctatc
ttcgactgggaacaggtgatccgcaaaaatgggattgtctatatcgggctggatgcgctg
tctgacagtgatgtggcctcggcggtaggcaacagcatgtttgcagatttggtcagtgtc
gccgggcaaatttacaaatatggcatgaacgccggattgccggtacgtcatgacggtaag
ctagcgattaacctgcattgtgatgaattcaatgaactgatgggcgatgaatttattccg
ctgattaataaaggtggcggcgcgggcatgcaggtgacggcatatacccagacctcctcc
gatatcgaggcccgtatcggcagcatggccaaaacggcgcaggtgataggtaacttcaac
actttgattatgttgcgtgtgcgggataaccggacggcagaacttctcaccagccagctg
ccggaagtggaaatctacagtaagaccctggtatcggggcattcagatattgctgatgtt
gaacaggggcaggattttacctcgtccacacaagatagggtaggcaccgtcaaaacacca
ctaattacgcccgctgaaatgattaacttgccgaaagggcaggcgtttgcgttattggaa
ggtgggcagttgtggaaaatccgtatgcctttgccaacgggagatgacgatgatgctctg
atgccggccaatttgcagaacatcgctgaacagatgcgcaggcactaccgcaccagtgaa
aattggtgggaagagaaggggtag

DBGET integrated database retrieval system