KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3395
Entry
XBJ1_3395         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein; putative exported protein
Organism
xbo  Xenorhabdus bovienii SS-2004
SSDB
Motif
Pfam: DUF2895 CAS_CSE1
Other DBs
NCBI-ProteinID: CBJ82513
UniProt: D3V4D4
Position
3306063..3306719
AA seq 218 aa
MSRFRHALKNRDQHILTLRLVCGVLILVLLITLTGWMTSPRSLTIHNPPDLRSGSTRPWW
EVPAPSVYSFAFYLFQQLNAWPKNGAQDYPAKIAALSPYLTPACQDFLQEDAKTRADSGE
LLDRVRVVYEIPGRGYGTKSVTVRNRDNWVVRLDLVADEYYHAEPVKRALVRYSLKVVRW
EGDAERNPFGLALDCYDRMPQRLEAMPQPVEEKKGVFQ
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagccggtttcgtcatgcgctgaaaaaccgtgaccagcatattctgaccctgcggctt
gtctgcggggtgctgatactggtcttgctgattacgctcacgggctggatgacgtcaccg
cgtagtctcaccatccataatccgccggacttacgcagcggcagcacccgcccgtggtgg
gaagtgcctgcgccgagtgtctacagttttgccttttatcttttccagcaactgaacgcc
tggccgaaaaacggggcacaggactacccggctaaaattgcggctttgtcgccttacctg
acccccgcctgtcaggattttttgcaggaggatgccaaaacccgggccgacagtggtgag
ctgcttgatcgggtgcgggtggtgtatgagatccccggccggggctacgggacgaaaagt
gtgacggtgcgtaaccgggataactgggtggtgcggctggatttggtggccgatgaatat
tatcacgccgagccggtcaaacgggcgctggtgcgctattccctgaaagtggtgcgctgg
gagggcgatgcggagcgtaatcctttcgggctggcactggattgttacgacaggatgccg
cagcgtctggaagcgatgccgcaacctgtggaagagaaaaagggggtgttccaatga

DBGET integrated database retrieval system